Search Antibody, Protein, and ELISA Kit Solutions

KMT5B Antibody - C-terminal region (ARP51247_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51247_P050-FITC Conjugated

ARP51247_P050-HRP Conjugated

ARP51247_P050-Biotin Conjugated

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
CHIP, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
KMT5B
Official Gene Full Name:
lysine methyltransferase 5B
NCBI Gene Id:
225888
Protein Name:
histone-lysine N-methyltransferase KMT5B
Swissprot Id:
Q3U8K7-4
Protein Accession #:
NP_001161356
Nucleotide Accession #:
NM_001167884
Alias Symbols:
AA117471, Suv420h1, Suv4-20h1, C630029K18Rik
Replacement Item:
This antibody may replace item sc-134048 from Santa Cruz Biotechnology.
Protein Size (# AA):
327
Molecular Weight:
35kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KMT5B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KMT5B.
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 77%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-Suv420h1 (ARP51247_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Rbl2; Rbl1; Rb1; Cbx1;
Blocking Peptide:
For anti-KMT5B (ARP51247_P050) antibody is Catalog # AAP51247 (Previous Catalog # AAPS26702)
Datasheets/Manuals:
Printable datasheet for anti-KMT5B (ARP51247_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...