Search Antibody, Protein, and ELISA Kit Solutions

KMO Antibody - middle region (ARP89313_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
KMO
Official Gene Full Name:
kynurenine 3-monooxygenase (kynurenine 3-hydroxylase)
NCBI Gene Id:
98256
Protein Name:
AI046660
Swissprot Id:
Q91WN4
Protein Accession #:
NP_598570.1
Nucleotide Accession #:
NM_133809.1
Alias Symbols:
AI046660
Description of Target:
Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). Required for synthesis of quinolinic acid, a neurotoxic NMDA receptor antagonist and potential endogenous inhibitor of NMDA receptor signaling in axonal targeting, synaptogenesis and apoptosis during brain development. Quinolinic acid may also affect NMDA receptor signaling in pancreatic beta cells, osteoblasts, myocardial cells, and the gastrointestinal tract.
Protein Size (# AA):
479
Molecular Weight:
52 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KMO.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KMO.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse KMO
Predicted Species Reactivity:
Mouse
Tested Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: QGMNAGFEDCLVFDELMDKFNNNLSMCLPEFSRFRIPDDHAISDLSMYNY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KMO (ARP89313_P050) antibody is Catalog # AAP89313
Datasheets/Manuals:
Printable datasheet for anti-KMO (ARP89313_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...