- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-KLRK1 (ARP63274_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 79%; Dog: 86%; Guinea Pig: 91%; Horse: 86%; Human: 100%; Mouse: 92%; Rabbit: 86%; Rat: 93% |
Peptide Sequence | Synthetic peptide located within the following region: HIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNT |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-KLRK1 (ARP63274_P050) antibody is Catalog # AAP63274 |
Gene Symbol | KLRK1 |
---|---|
Gene Full Name | Killer cell lectin-like receptor subfamily K, member 1 |
Alias Symbols | KLR, CD314, NKG2D, NKG2-D, D12S2489E |
NCBI Gene Id | 22914 |
Protein Name | NKG2-D type II integral membrane protein |
Description of Target | Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. This gene encodes a member of the NKG2 family. The encoded transmembrane protein is characterized by a type II membrane orientation (has an extracellular C terminus) and the presence of a C-type lectin domain. It binds to a diverse family of ligands that include MHC class I chain-related A and B proteins and UL-16 binding proteins, where ligand-receptor interactions can result in the activation of NK and T cells. The surface expression of these ligands is important for the recognition of stressed cells by the immune system, and thus this protein and its ligands are therapeutic targets for the treatment of immune diseases and cancers. Read-through transcription exists between this gene and the upstream KLRC4 (killer cell lectin-like receptor subfamily C, member 4) family member in the same cluster. |
Uniprot ID | P26718 |
Protein Accession # | NP_031386 |
Nucleotide Accession # | NM_007360 |
Protein Size (# AA) | 216 |
Molecular Weight | 24kDa |
Protein Interactions | KLRK1; RAET1G; RAET1E; ULBP3; HLA-B; TYROBP; HCST; MICB; RAE1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "KLRK1 Antibody - C-terminal region (ARP63274_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".
-
How long will it take to receive "KLRK1 Antibody - C-terminal region (ARP63274_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "KLRK1 Antibody - C-terminal region (ARP63274_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "KLRK1 Antibody - C-terminal region (ARP63274_P050)"?
This target may also be called "KLR, CD314, NKG2D, NKG2-D, D12S2489E" in publications.
-
What is the shipping cost for "KLRK1 Antibody - C-terminal region (ARP63274_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "KLRK1 Antibody - C-terminal region (ARP63274_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "KLRK1 Antibody - C-terminal region (ARP63274_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "24kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "KLRK1 Antibody - C-terminal region (ARP63274_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "KLRK1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "KLRK1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "KLRK1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "KLRK1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "KLRK1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "KLRK1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.