KLRK1 Antibody - C-terminal region (ARP63273_P050)

Catalog No: ARP63273_P050

WB Suggested Anti-KLRK1 Antibody
Titration: 1.0 ug/ml
Positive Control: RPMI-8226 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Human: 100%; Mouse: 79%; Rat: 79%
• Peptide Sequence: Synthetic peptide located within the following region: YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWED
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KLRK1 (ARP63273_P050) antibody is Catalog # AAP63273

Target Info

• Gene Symbol: KLRK1
• Gene Full Name: Killer cell lectin-like receptor subfamily K, member 1
• Alias Symbols: KLR, CD314, NKG2D, NKG2-D, D12S2489E
• NCBI Gene Id: 22914
• Protein Name: NKG2-D type II integral membrane protein
• Description of Target: Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. This gene encodes a member of the NKG2 family. The encoded transmembrane protein is characterized by a type II membrane orientation (has an extracellular C terminus) and the presence of a C-type lectin domain. It binds to a diverse family of ligands that include MHC class I chain-related A and B proteins and UL-16 binding proteins, where ligand-receptor interactions can result in the activation of NK and T cells. The surface expression of these ligands is important for the recognition of stressed cells by the immune system, and thus this protein and its ligands are therapeutic targets for the treatment of immune diseases and cancers. Read-through transcription exists between this gene and the upstream KLRC4 (killer cell lectin-like receptor subfamily C, member 4) family member in the same cluster.
• Uniprot ID: P26718
• Protein Accession #: NP_031386
• Nucleotide Accession #: NM_007360
• Protein Size (# AA): 216
• Molecular Weight: 24kDa
• Protein Interactions: KLRK1; RAET1G; RAET1E; ULBP3; HLA-B; TYROBP; HCST; MICB; RAE1;