Protein on Demand™ KLKB1 Recombinant Protein (Human) (OPCA23528)

Datasheets/Manuals	Printable datasheet for OPCA23528

Product Info
Predicted Species Reactivity	Human
Product Format	Liquid
Application	WB, ELISA
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTR
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	20-390

Gene Full Name	kallikrein B1
Alias Symbols	PKK, PPK, KLK3, PKKD
NCBI Gene Id	3818
Protein Name	plasma kallikrein
Description of Target	This gene encodes a glycoprotein that participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. The encoded preproprotein present in plasma as a non-covalent complex with high molecular weight
Uniprot ID	P03952
Protein Accession #	NP_000883.2
Nucleotide Accession #	NM_000892.4
Protein Size (# AA)	371