KLK7 Recombinant Protein (Rat) (OPCA01677)

Catalog No: OPCA01677

Klk7 Recombinant Protein (Rat) (OPCA01677) in SDS-PAGE showing the molecular weight of approximately 30.38 kDa.

Klk7 Recombinant Protein (Rat) (OPCA01677) in SDS-PAGE showing the molecular weight of approximately 30.38 kDa.

Product Info

• Predicted Species Reactivity: Rat|Rattus norvegicus
• Product Format: Liquid or Lyophilized powder
• Host: Rat
• Additional Information: Relevance: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Predominant kallikrein protein in the kidney.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: VIGGYKCEKNSQPWQVALYSFTKYLCGGVLIDPSWVITAAHCSSNNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPDYKPFLMRNHTRKPGDDHSNDLMLLHLSQPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLIWEFPDDLQCVNIHLLSNEKCIKAYKEKVTDLMLCAGELEGGKDTCTGDSGGPLLCDGVLQGITSWGSVPCAKTNMPAIYTKLIKFTSWIKEVMKENP
• Protein Sequence: VIGGYKCEKNSQPWQVALYSFTKYLCGGVLIDPSWVITAAHCSSNNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPDYKPFLMRNHTRKPGDDHSNDLMLLHLSQPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLIWEFPDDLQCVNIHLLSNEKCIKAYKEKVTDLMLCAGELEGGKDTCTGDSGGPLLCDGVLQGITSWGSVPCAKTNMPAIYTKLIKFTSWIKEVMKENP
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 25-261 aa
• Tag: N-terminal 6xHis-tagged
• Reference: The expression of two kallikrein gene family members in the rat kidney.Brady J.M., MacDonald R.J.Arch. Biochem. Biophys. 278:342-349(1990)

Target Info

• Gene Symbol: Klk1
• Gene Full Name: kallikrein 1
• Alias Symbols: esterase B;glandular kallikrein-7, submandibular/renal;Kal;KALA;kallikrein 1;Kallikrein 1, renal/pancreas/salivary;kallikrein 1-like peptidase;kallikrein 1-related peptidase C7;kallikrein 5;kallikrein 7;kallikrein a3;kallikrein-related protein K1;Klk1c7;Klk1l;Klk5;Klk7;Klna3;proteinase A;RATKALA;renal kallikrein;RGK-7;RSKG-7;tissue kallikrein.
• NCBI Gene Id: 24523
• Protein Name: Glandular kallikrein-7, submandibular/renal
• Description of Target: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Predominant kallikrein protein in the kidney.
• Uniprot ID: P36373
• Protein Accession #: NP_036725.1
  
• Nucleotide Accession #: NM_012593.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 30.3 kDa