KLK7 Antibody - middle region : FITC (ARP57735_P050-FITC)

Catalog No: ARP57735_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human KLK7
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 86%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: IKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KLK7 (ARP57735_P050-FITC) antibody is Catalog # AAP57735

Target Info

• Gene Symbol: KLK7
• Gene Full Name: kallikrein-related peptidase 7
• Alias Symbols: hK7, SCCE, PRSS6
• NCBI Gene Id: 5650
• Protein Name: Kallikrein-7
• Description of Target: This gene encodes a member of the kallikrein subfamily of serine proteases. These enzymes have diverse physiological functions and many kallikrein genes are biomarkers for cancer. The encoded protein has chymotrypsin-like activity and plays a role in the proteolysis of intercellular cohesive structures that precedes desquamation, the shedding of the outermost layer of the epidermis. The encoded protein may play a role in cancer invasion and metastasis, and increased expression of this gene is associated with unfavorable prognosis and progression of several types of cancer. Polymorphisms in this gene may play a role in the development of atopic dermatitis.
• Uniprot ID: P49862-2
• Protein Size (# AA): 181
• Molecular Weight: 19kDa
• Protein Interactions: APP; UBC; CDSN;