Search Antibody, Protein, and ELISA Kit Solutions

KLK3 Antibody - middle region : FITC (ARP41879_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41879_P050 Unconjugated

ARP41879_P050-HRP Conjugated

ARP41879_P050-Biotin Conjugated

Predicted Species Reactivity:
Dog, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item:
This antibody may replace item sc-116410 from Santa Cruz Biotechnology.
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Dog: 77%; Human: 100%; Mouse: 86%; Rat: 86%
Complete computational species homology data:
Anti-KLK3 (ARP41879_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSI
0.5 mg/ml
Blocking Peptide:
For anti-KLK3 (ARP41879_P050-FITC) antibody is Catalog # AAP41879
Printable datasheet for anti-KLK3 (ARP41879_P050-FITC) antibody
Gene Symbol:
Official Gene Full Name:
Kallikrein-related peptidase 3
Alias Symbols:
NCBI Gene Id:
Protein Name:
Prostate-specific antigen
Description of Target:
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its protein product is a protease present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. Serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KLK3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KLK3.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...