SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP41879_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP41879_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

KLK3 Antibody - middle region : FITC (ARP41879_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-KLK3 (ARP41879_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Dog
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 77%; Human: 100%; Mouse: 86%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: LRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSI
Concentration0.5 mg/ml
Blocking PeptideFor anti-KLK3 (ARP41879_P050-FITC) antibody is Catalog # AAP41879
Gene SymbolKLK3
Gene Full NameKallikrein-related peptidase 3
Alias SymbolsAPS, PSA, hK3, KLK2A1
NCBI Gene Id354
Protein NameProstate-specific antigen
Description of TargetKallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its protein product is a protease present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. Serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms.
Uniprot IDP07288
Protein Accession #NP_001639
Nucleotide Accession #NM_001648
Protein Size (# AA)261
Molecular Weight26kDa
Protein InteractionsALB; PZP; SERPINA5; SERPINA1; SEMG2; SEMG1; PLG; PTHLH; IGFBP3; FN1; EPOR; SLPI; SERPINA3; A2M; POLR2A; AR; KAT5; RUVBL1; CTNNB1;
  1. What is the species homology for "KLK3 Antibody - middle region : FITC (ARP41879_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog".

  2. How long will it take to receive "KLK3 Antibody - middle region : FITC (ARP41879_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KLK3 Antibody - middle region : FITC (ARP41879_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KLK3 Antibody - middle region : FITC (ARP41879_P050-FITC)"?

    This target may also be called "APS, PSA, hK3, KLK2A1" in publications.

  5. What is the shipping cost for "KLK3 Antibody - middle region : FITC (ARP41879_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KLK3 Antibody - middle region : FITC (ARP41879_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KLK3 Antibody - middle region : FITC (ARP41879_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "26kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KLK3 Antibody - middle region : FITC (ARP41879_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KLK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KLK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KLK3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KLK3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KLK3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KLK3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KLK3 Antibody - middle region : FITC (ARP41879_P050-FITC)
Your Rating
We found other products you might like!