Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP41879_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41879_P050-FITC Conjugated

ARP41879_P050-HRP Conjugated

ARP41879_P050-Biotin Conjugated

KLK3 Antibody - middle region (ARP41879_P050)

Catalog#: ARP41879_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-116410 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 77%; Human: 100%; Mouse: 86%; Rat: 86%
Complete computational species homology data Anti-KLK3 (ARP41879_P050)
Peptide Sequence Synthetic peptide located within the following region: LRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KLK3 (ARP41879_P050) antibody is Catalog # AAP41879
Datasheets/Manuals Printable datasheet for anti-KLK3 (ARP41879_P050) antibody
Publications

Alzghoul, S; Hailat, M; Zivanovic, S; Que, L; Shah, GV; Measurement of serum prostate cancer markers using a nanopore thin film based optofluidic chip. 77, 491-8 (2016). WB, Dog, Human, Mouse, Rat 26457734

Gene Symbol KLK3
Official Gene Full Name Kallikrein-related peptidase 3
Alias Symbols APS, KLK2A1, PSA, hK3
NCBI Gene Id 354
Protein Name Prostate-specific antigen
Description of Target Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its protein product is a protease present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. Serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms.
Swissprot Id P07288
Protein Accession # NP_001639
Nucleotide Accession # NM_001648
Protein Size (# AA) 261
Molecular Weight 26kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KLK3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KLK3.
Protein Interactions ALB; PZP; SERPINA5; SERPINA1; SEMG2; SEMG1; PLG; PTHLH; IGFBP3; FN1; EPOR; SLPI; SERPINA3; A2M; POLR2A; AR; KAT5; RUVBL1; CTNNB1;
  1. What is the species homology for "KLK3 Antibody - middle region (ARP41879_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Human, Mouse, Rat".

  2. How long will it take to receive "KLK3 Antibody - middle region (ARP41879_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KLK3 Antibody - middle region (ARP41879_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KLK3 Antibody - middle region (ARP41879_P050)"?

    This target may also be called "APS, KLK2A1, PSA, hK3" in publications.

  5. What is the shipping cost for "KLK3 Antibody - middle region (ARP41879_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KLK3 Antibody - middle region (ARP41879_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KLK3 Antibody - middle region (ARP41879_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "26kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KLK3 Antibody - middle region (ARP41879_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KLK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KLK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KLK3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KLK3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KLK3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KLK3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KLK3 Antibody - middle region (ARP41879_P050)
Your Rating
We found other products you might like!