Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP41879_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41879_P050-FITC Conjugated

ARP41879_P050-HRP Conjugated

ARP41879_P050-Biotin Conjugated

KLK3 Antibody - middle region (ARP41879_P050)

Catalog#: ARP41879_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-116410 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 77%; Human: 100%; Mouse: 86%; Rat: 86%
Complete computational species homology data Anti-KLK3 (ARP41879_P050)
Peptide Sequence Synthetic peptide located within the following region: LRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KLK3 (ARP41879_P050) antibody is Catalog # AAP41879
Datasheets/Manuals Printable datasheet for anti-KLK3 (ARP41879_P050) antibody
Publications

Alzghoul, S; Hailat, M; Zivanovic, S; Que, L; Shah, GV; Measurement of serum prostate cancer markers using a nanopore thin film based optofluidic chip. 77, 491-8 (2016). WB, Dog, Human, Mouse, Rat 26457734

Gene Symbol KLK3
Official Gene Full Name Kallikrein-related peptidase 3
Alias Symbols APS, KLK2A1, PSA, hK3
NCBI Gene Id 354
Protein Name Prostate-specific antigen
Description of Target Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its protein product is a protease present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. Serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms.
Swissprot Id P07288
Protein Accession # NP_001639
Nucleotide Accession # NM_001648
Protein Size (# AA) 261
Molecular Weight 26kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KLK3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KLK3.
Protein Interactions ALB; PZP; SERPINA5; SERPINA1; SEMG2; SEMG1; PLG; PTHLH; IGFBP3; FN1; EPOR; SLPI; SERPINA3; A2M; POLR2A; AR; KAT5; RUVBL1; CTNNB1;
Write Your Own Review
You're reviewing:KLK3 Antibody - middle region (ARP41879_P050)
Your Rating