- Tested Species Reactivity:
- Human
- Predicted Species Reactivity:
- Dog, Human, Mouse, Rat
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Application:
- WB
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Gene Symbol:
- KLK3
- Official Gene Full Name:
- Kallikrein-related peptidase 3
- NCBI Gene Id:
- 354
- Protein Name:
- Prostate-specific antigen
- Swissprot Id:
- P07288
- Protein Accession #:
- NP_001639
- Nucleotide Accession #:
- NM_001648
- Alias Symbols:
- APS, KLK2A1, PSA, hK3
- Replacement Item:
- This antibody may replace item sc-116410 from Santa Cruz Biotechnology.
- Description of Target:
- Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its protein product is a protease present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. Serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms.
- Protein Size (# AA):
- 261
- Molecular Weight:
- 26kDa
- Purification:
- Affinity Purified
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express KLK3.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express KLK3.
- Predicted Homology Based on Immunogen Sequence:
- Dog: 77%; Human: 100%; Mouse: 86%; Rat: 86%
- Complete computational species homology data:
- Anti-KLK3 (ARP41879_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: LRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSI
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- ALB; PZP; SERPINA5; SERPINA1; SEMG2; SEMG1; PLG; PTHLH; IGFBP3; FN1; EPOR; SLPI; SERPINA3; A2M; POLR2A; AR; KAT5; RUVBL1; CTNNB1;
- Blocking Peptide:
- For anti-KLK3 (ARP41879_P050) antibody is Catalog # AAP41879
- Datasheets/Manuals:
- Printable datasheet for anti-KLK3 (ARP41879_P050) antibody
- Publications:
Alzghoul, S; Hailat, M; Zivanovic, S; Que, L; Shah, GV; Measurement of serum prostate cancer markers using a nanopore thin film based optofluidic chip. 77, 491-8 (2016). WB, Dog, Human, Mouse, Rat 26457734
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
