Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP39220_P050-FITC Conjugated

ARP39220_P050-HRP Conjugated

ARP39220_P050-Biotin Conjugated

KLHL5 Antibody - N-terminal region (ARP39220_P050)

Catalog#: ARP39220_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-102002 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the n terminal region of human KLHL5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 77%; Rat: 100%; Zebrafish: 75%
Complete computational species homology dataAnti-KLHL5 (ARP39220_P050)
Peptide SequenceSynthetic peptide located within the following region: MSGSRKEFDVKQILKIRWRWFGHQASSPNSTVDSQQGEFWNRGQTGANGG
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-KLHL5 (ARP39220_P050) antibody is Catalog # AAP39220 (Previous Catalog # AAPY00832)
Datasheets/ManualsPrintable datasheet for anti-KLHL5 (ARP39220_P050) antibody
Target ReferenceHillier,L.W., (2005) Nature 434 (7034), 724-731

Nagalla, S. et al. Platelet microRNA-mRNA coexpression profiles correlate with platelet reactivity. Blood 117, 5189-97 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21415270

Gene SymbolKLHL5
Official Gene Full NameKelch-like 5 (Drosophila)
Alias Symbols-
NCBI Gene Id51088
Protein NameKelch-like protein 5
Description of TargetThe kelch-repeat protein family is a recently found new kind of actin-binding protein. It is characterized by tandemly arranged motifs of about 50 amino acids. Most members of the kelch-repeat family were cytoskeletal proteins implicated in various cellular processes, such as actin cytoskeleton interaction, cytoplasmic sequestration of transcription factors and cell morphology. During the large-scale sequencing analysis of a human fetal brain cDNA library we found a novel kelch-like protein gene 5, KLHL5, KLHL5 has high identity with Drosophila kelch protein and many other family members. A novel splicing variants of KLHL5, named KLHL5b and the expression pattern of KLHL5b in many tissues.
Swissprot IdQ96PQ7
Protein Accession #NP_001007076
Nucleotide Accession #NM_001007075
Protein Size (# AA)709
Molecular Weight79kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express KLHL5.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express KLHL5.
Protein InteractionsFUS; CUL3; UBC; MAP1LC3B; GABARAPL2; TK1; SMN1;
  1. What is the species homology for "KLHL5 Antibody - N-terminal region (ARP39220_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "KLHL5 Antibody - N-terminal region (ARP39220_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KLHL5 Antibody - N-terminal region (ARP39220_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "KLHL5 Antibody - N-terminal region (ARP39220_P050)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "KLHL5 Antibody - N-terminal region (ARP39220_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KLHL5 Antibody - N-terminal region (ARP39220_P050)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "KLHL5 Antibody - N-terminal region (ARP39220_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "79kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KLHL5 Antibody - N-terminal region (ARP39220_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KLHL5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KLHL5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KLHL5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KLHL5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KLHL5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KLHL5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KLHL5 Antibody - N-terminal region (ARP39220_P050)
Your Rating
Aviva Travel Grant
Aviva Validation Data
Aviva HIS tag Deal
Aviva Tips and Tricks