Search Antibody, Protein, and ELISA Kit Solutions

KLHL5 Antibody - N-terminal region (ARP39220_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39220_P050-FITC Conjugated

ARP39220_P050-HRP Conjugated

ARP39220_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Kelch-like 5 (Drosophila)
NCBI Gene Id:
Protein Name:
Kelch-like protein 5
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-102002 from Santa Cruz Biotechnology.
Description of Target:
The kelch-repeat protein family is a recently found new kind of actin-binding protein. It is characterized by tandemly arranged motifs of about 50 amino acids. Most members of the kelch-repeat family were cytoskeletal proteins implicated in various cellular processes, such as actin cytoskeleton interaction, cytoplasmic sequestration of transcription factors and cell morphology. During the large-scale sequencing analysis of a human fetal brain cDNA library we found a novel kelch-like protein gene 5, KLHL5, KLHL5 has high identity with Drosophila kelch protein and many other family members. A novel splicing variants of KLHL5, named KLHL5b and the expression pattern of KLHL5b in many tissues.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KLHL5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KLHL5.
The immunogen is a synthetic peptide directed towards the n terminal region of human KLHL5
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 77%; Rat: 100%; Zebrafish: 75%
Complete computational species homology data:
Anti-KLHL5 (ARP39220_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MSGSRKEFDVKQILKIRWRWFGHQASSPNSTVDSQQGEFWNRGQTGANGG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-KLHL5 (ARP39220_P050) antibody is Catalog # AAP39220 (Previous Catalog # AAPY00832)
Printable datasheet for anti-KLHL5 (ARP39220_P050) antibody
Target Reference:
Hillier,L.W., (2005) Nature 434 (7034), 724-731

Nagalla, S. et al. Platelet microRNA-mRNA coexpression profiles correlate with platelet reactivity. Blood 117, 5189-97 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21415270

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...