Search Antibody, Protein, and ELISA Kit Solutions

KLF8 Antibody - N-terminal region (ARP31533_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31533_P050-FITC Conjugated

ARP31533_P050-HRP Conjugated

ARP31533_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Kruppel-like factor 8
NCBI Gene Id:
Protein Name:
Krueppel-like factor 8
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
BKLF3, DKFZp686O08126, DXS741, MGC138314, ZNF741
Replacement Item:
This antibody may replace item sc-133713 from Santa Cruz Biotechnology.
Description of Target:
KLF8 is abnormally expressed in female patients with X autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KLF8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KLF8.
The immunogen is a synthetic peptide directed towards the N terminal region of human KLF8
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Rabbit
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 79%; Horse: 77%; Human: 100%; Rabbit: 86%
Complete computational species homology data:
Anti-KLF8 (ARP31533_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-KLF8 (ARP31533_P050) antibody is Catalog # AAP31533 (Previous Catalog # AAPP02295)
Printable datasheet for anti-KLF8 (ARP31533_P050) antibody
Target Reference:
Lossi,A.M., et al., (2002) J. Med. Genet. 39 (2), 113-117

Fu, W.-J. et al. Small interference RNA targeting Krüppel-like factor 8 inhibits the renal carcinoma 786-0 cells growth in vitro and in vivo. J. Cancer Res. Clin. Oncol. 136, 1255-65 (2010). IHC, WB, Cow, Dog, Horse, Human, Rabbit 20182889

Han, S. et al. Krüppel‑like factor expression and correlation with FAK, MMP‑9 and E‑cadherin expression in hepatocellular carcinoma. Mol. Med. Rep. 8, 81-8 (2013). IHC, WB, Cow, Dog, Horse, Human, Rabbit 23670717

Li, J.-C. et al. Up-regulation of Krüppel-like factor 8 promotes tumor invasion and indicates poor prognosis for hepatocellular carcinoma. Gastroenterology 139, 2146-2157.e12 (2010). IHC, WB, Cow, Dog, Horse, Human, Rabbit 20728449

Yan, Q; Zhang, W; Wu, Y; Wu, M; Zhang, M; Shi, X; Zhao, J; Nan, Q; Chen, Y; Wang, L; Cheng, T; Li, J; Bai, Y; Liu, S; Wang, J; KLF8 promotes tumorigenesis, invasion and metastasis of colorectal cancer cells by transcriptional activation of FHL2. 6, 25402-17 (2015). IHC, WB, Cow, Dog, Horse, Human, Rabbit 26320172

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...