Search Antibody, Protein, and ELISA Kit Solutions

KLF8 antibody - N-terminal region (ARP31533_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31533_P050-FITC Conjugated

ARP31533_P050-HRP Conjugated

ARP31533_P050-Biotin Conjugated

Gene Symbol:
KLF8
NCBI Gene Id:
11279
Official Gene Full Name:
Kruppel-like factor 8
Protein Name:
Krueppel-like factor 8
Swissprot Id:
O95600
Protein Accession #:
NP_009181
Nucleotide Accession #:
NM_007250
Alias Symbols:
BKLF3, DKFZp686O08126, DXS741, MGC138314, ZNF741
Replacement Item:
This antibody may replace item sc-133713 from Santa Cruz Biotechnology.
Description of Target:
KLF8 is abnormally expressed in female patients with X autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation.
Protein Size (# AA):
359
Molecular Weight:
39kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KLF8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KLF8.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human KLF8
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 79%; Horse: 77%; Human: 100%; Rabbit: 86%
Complete computational species homology data:
Anti-KLF8 (ARP31533_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Dlg4; APP; UBC; XPO1; PARP1; KAT2B; EP300; CREBBP; FHL3; CTBP2;
Blocking Peptide:
For anti-KLF8 (ARP31533_P050) antibody is Catalog # AAP31533 (Previous Catalog # AAPP02295)
Datasheets/Manuals:
Printable datasheet for anti-KLF8 (ARP31533_P050) antibody
Target Reference:
Lossi,A.M., et al., (2002) J. Med. Genet. 39 (2), 113-117
Publications:

Fu, W.-J. et al. Small interference RNA targeting Krüppel-like factor 8 inhibits the renal carcinoma 786-0 cells growth in vitro and in vivo. J. Cancer Res. Clin. Oncol. 136, 1255-65 (2010). IHC, WB, Cow, Dog, Horse, Human, Rabbit 20182889

Li, J.-C. et al. Up-regulation of Krüppel-like factor 8 promotes tumor invasion and indicates poor prognosis for hepatocellular carcinoma. Gastroenterology 139, 2146-2157.e12 (2010). IHC, WB, Cow, Dog, Horse, Human, Rabbit 20728449

Han, S. et al. Krüppel‑like factor expression and correlation with FAK, MMP‑9 and E‑cadherin expression in hepatocellular carcinoma. Mol. Med. Rep. 8, 81-8 (2013). IHC, WB, Cow, Dog, Horse, Human, Rabbit 23670717

Yan, Q; Zhang, W; Wu, Y; Wu, M; Zhang, M; Shi, X; Zhao, J; Nan, Q; Chen, Y; Wang, L; Cheng, T; Li, J; Bai, Y; Liu, S; Wang, J; KLF8 promotes tumorigenesis, invasion and metastasis of colorectal cancer cells by transcriptional activation of FHL2. 6, 25402-17 (2015). IHC, WB, Cow, Dog, Horse, Human, Rabbit 26320172

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...