Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP31533_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31533_P050-FITC Conjugated

ARP31533_P050-HRP Conjugated

ARP31533_P050-Biotin Conjugated

KLF8 Antibody - N-terminal region (ARP31533_P050)

Catalog#: ARP31533_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Horse, Human, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-133713 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human KLF8
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 79%; Horse: 77%; Human: 100%; Rabbit: 86%
Complete computational species homology dataAnti-KLF8 (ARP31533_P050)
Peptide SequenceSynthetic peptide located within the following region: LSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTV
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-KLF8 (ARP31533_P050) antibody is Catalog # AAP31533 (Previous Catalog # AAPP02295)
Datasheets/ManualsPrintable datasheet for anti-KLF8 (ARP31533_P050) antibody
Target ReferenceLossi,A.M., et al., (2002) J. Med. Genet. 39 (2), 113-117
Publications

Fu, W.-J. et al. Small interference RNA targeting Krüppel-like factor 8 inhibits the renal carcinoma 786-0 cells growth in vitro and in vivo. J. Cancer Res. Clin. Oncol. 136, 1255-65 (2010). IHC, WB, Cow, Dog, Horse, Human, Rabbit 20182889

Han, S. et al. Krüppel‑like factor expression and correlation with FAK, MMP‑9 and E‑cadherin expression in hepatocellular carcinoma. Mol. Med. Rep. 8, 81-8 (2013). IHC, WB, Cow, Dog, Horse, Human, Rabbit 23670717

Li, J.-C. et al. Up-regulation of Krüppel-like factor 8 promotes tumor invasion and indicates poor prognosis for hepatocellular carcinoma. Gastroenterology 139, 2146-2157.e12 (2010). IHC, WB, Cow, Dog, Horse, Human, Rabbit 20728449

Yan, Q; Zhang, W; Wu, Y; Wu, M; Zhang, M; Shi, X; Zhao, J; Nan, Q; Chen, Y; Wang, L; Cheng, T; Li, J; Bai, Y; Liu, S; Wang, J; KLF8 promotes tumorigenesis, invasion and metastasis of colorectal cancer cells by transcriptional activation of FHL2. 6, 25402-17 (2015). IHC, WB, Cow, Dog, Horse, Human, Rabbit 26320172

Gene SymbolKLF8
Official Gene Full NameKruppel-like factor 8
Alias SymbolsBKLF3, DKFZp686O08126, DXS741, MGC138314, ZNF741
NCBI Gene Id11279
Protein NameKrueppel-like factor 8
Description of TargetKLF8 is abnormally expressed in female patients with X autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation.
Swissprot IdO95600
Protein Accession #NP_009181
Nucleotide Accession #NM_007250
Protein Size (# AA)359
Molecular Weight39kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express KLF8.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express KLF8.
Protein InteractionsDlg4; APP; UBC; XPO1; PARP1; KAT2B; EP300; CREBBP; FHL3; CTBP2;
Write Your Own Review
You're reviewing:KLF8 Antibody - N-terminal region (ARP31533_P050)
Your Rating
Aviva Live Chat
Aviva Blast Tool
Aviva ChIP Antibodies
Aviva Validation Data