Search Antibody, Protein, and ELISA Kit Solutions

KLF6 Antibody - middle region (ARP89513_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Mouse
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
KLF6
Official Gene Full Name:
Kruppel-like factor 6
NCBI Gene Id:
23849
Protein Name:
Krueppel-like factor 6
Swissprot Id:
O08584
Alias Symbols:
FM2, FM6, Zf9, BCD1, CPBP, Copeb, C86813, R75280, Ierepo1, Ierepo3, AI448727
Description of Target:
Transcriptional activator. Binds a GC box motif. Could play a role in B-cell growth and development (By similarity).
Protein Size (# AA):
283
Molecular Weight:
31 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KLF6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KLF6.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse KLF6
Peptide Sequence:
Synthetic peptide located within the following region: LKISSSPPEDSLISSSFNYNLETNSLNSDVSSESSDSSEELSPTTKFTSD
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KLF6 (ARP89513_P050) antibody is Catalog # AAP89513
Datasheets/Manuals:
Printable datasheet for anti-KLF6 (ARP89513_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...