Search Antibody, Protein, and ELISA Kit Solutions

KLF5 Antibody - C-terminal region : FITC (ARP74920_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74920_P050 Unconjugated

ARP74920_P050-HRP Conjugated

ARP74920_P050-Biotin Conjugated

Gene Symbol:
KLF5
NCBI Gene Id:
688
Swissprot Id:
Q13887
Protein Accession #:
NP_001721
Alias Symbols:
KLF5, BTEB2, CKLF, IKLF,
Replacement Item:
This antibody may replace item sc-118867 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the Kruppel-like factor subfamily of zinc finger proteins. The encoded protein is a transcriptional activator that binds directly to a specific recognition motif in the promoters of target genes. This protein acts downstream of multiple different signaling pathways and is regulated by post-translational modification. It may participate in both promoting and suppressing cell proliferation. Expression of this gene may be changed in a variety of different cancers and in cardiovascular disease. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
457
Molecular Weight:
50kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KLF5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KLF5.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KLF5
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: PVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
FBXW7; UBC; EP300; ZBTB17; SMAD4; SMAD3; SMAD2; RRBP1; ELAVL1; YAP1; TRIM25; WWP1; SMURF2; WWTR1; GSK3B; ESR2; RARA; HDAC2; HDAC1; ESR1; SET; CREBBP; GTF2F2; GTF2E2; PRKCD; NFKB1; TBP; GTF2F1; GTF2B; PRKCA;
Blocking Peptide:
For anti-KLF5 (ARP74920_P050-FITC) antibody is Catalog # AAP74920
Datasheets/Manuals:
Printable datasheet for anti-KLF5 (ARP74920_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...