Size:100 ul
$289.00
In Stock
SKU
ARP74920_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP74920_P050 Unconjugated

ARP74920_P050-HRP Conjugated

ARP74920_P050-Biotin Conjugated

KLF5 Antibody - C-terminal region : FITC (ARP74920_P050-FITC)

Catalog#: ARP74920_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-118867 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human KLF5
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: PVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTH
Concentration0.5 mg/ml
Blocking PeptideFor anti-KLF5 (ARP74920_P050-FITC) antibody is Catalog # AAP74920
Datasheets/ManualsPrintable datasheet for anti-KLF5 (ARP74920_P050-FITC) antibody
Gene SymbolKLF5
Alias SymbolsKLF5, BTEB2, CKLF, IKLF,
NCBI Gene Id688
Description of TargetThis gene encodes a member of the Kruppel-like factor subfamily of zinc finger proteins. The encoded protein is a transcriptional activator that binds directly to a specific recognition motif in the promoters of target genes. This protein acts downstream of multiple different signaling pathways and is regulated by post-translational modification. It may participate in both promoting and suppressing cell proliferation. Expression of this gene may be changed in a variety of different cancers and in cardiovascular disease. Alternative splicing results in multiple transcript variants.
Swissprot IdQ13887
Protein Accession #NP_001721
Protein Size (# AA)457
Molecular Weight50kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express KLF5.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express KLF5.
Protein InteractionsFBXW7; UBC; EP300; ZBTB17; SMAD4; SMAD3; SMAD2; RRBP1; ELAVL1; YAP1; TRIM25; WWP1; SMURF2; WWTR1; GSK3B; ESR2; RARA; HDAC2; HDAC1; ESR1; SET; CREBBP; GTF2F2; GTF2E2; PRKCD; NFKB1; TBP; GTF2F1; GTF2B; PRKCA;
Write Your Own Review
You're reviewing:KLF5 Antibody - C-terminal region : FITC (ARP74920_P050-FITC)
Your Rating
Free Microscope
Aviva HIS tag Deal
Aviva Validation Data
Aviva Tissue Tool