SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP38927_P050
Price: $0.00
SKU
ARP38927_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-KLF12 (ARP38927_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human KLF12
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 93%; Human: 100%; Rabbit: 86%
Peptide SequenceSynthetic peptide located within the following region: NIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDM
Concentration0.5 mg/ml
Blocking PeptideFor anti-KLF12 (ARP38927_P050) antibody is Catalog # AAP38927 (Previous Catalog # AAPY00736)
Sample Type Confirmation

KLF12 is strongly supported by BioGPS gene expression data to be expressed in 721_B

ReferenceSuda,S., (2006) Biochem. Biophys. Res. Commun. 344 (1), 246-252
Gene SymbolKLF12
Gene Full NameKruppel-like factor 12
Alias SymbolsAP2REP, AP-2rep, HSPC122
NCBI Gene Id11278
Protein NameKrueppel-like factor 12
Description of TargetActivator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. KLF12 is a member of the Kruppel-like zinc finger protein family and can repress expression of the AP-2 alpha gene by binding to a specific site in the AP-2 alpha gene promoter. Repression by the encoded protein requires binding with a corepressor, CtBP1.Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. The protein encoded by this gene is a member of the Kruppel-like zinc finger protein family and can repress expression of the AP-2 alpha gene by binding to a specific site in the AP-2 alpha gene promoter. Repression by the encoded protein requires binding with a corepressor, CtBP1. Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDQ9Y4X4
Protein Accession #NP_009180
Nucleotide Accession #NM_007249
Protein Size (# AA)402
Molecular Weight44kDa
Protein InteractionsTHAP1; CTBP1; APP; EHMT2;
  1. What is the species homology for "KLF12 Antibody - N-terminal region (ARP38927_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog, Guinea Pig, Rabbit".

  2. How long will it take to receive "KLF12 Antibody - N-terminal region (ARP38927_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KLF12 Antibody - N-terminal region (ARP38927_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KLF12 Antibody - N-terminal region (ARP38927_P050)"?

    This target may also be called "AP2REP, AP-2rep, HSPC122" in publications.

  5. What is the shipping cost for "KLF12 Antibody - N-terminal region (ARP38927_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KLF12 Antibody - N-terminal region (ARP38927_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KLF12 Antibody - N-terminal region (ARP38927_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KLF12 Antibody - N-terminal region (ARP38927_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KLF12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KLF12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KLF12"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KLF12"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KLF12"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KLF12"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KLF12 Antibody - N-terminal region (ARP38927_P050)
Your Rating