Search Antibody, Protein, and ELISA Kit Solutions

KLF11 Antibody - C-terminal region (ARP38365_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP38365_P050-FITC Conjugated

ARP38365_P050-HRP Conjugated

ARP38365_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-136101 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the C terminal region of human KLF11
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-KLF11 (ARP38365_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KLF11 (ARP38365_P050) antibody is Catalog # AAP38365 (Previous Catalog # AAPP20551)
Printable datasheet for anti-KLF11 (ARP38365_P050) antibody
Target Reference:
Hromas,R., (er) J. Clin. Endocrinol. Metab. (2008) In press

Duncan, J; Wang, N; Zhang, X; Johnson, S; Harris, S; Zheng, B; Zhang, Q; Rajkowska, G; Miguel-Hidalgo, JJ; Sittman, D; Ou, XM; Stockmeier, CA; Wang, JM; Chronic Social Stress and Ethanol Increase Expression of KLF11, a Cell Death Mediator, in Rat Brain. 28, 18-31 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 25739536

Gene Symbol:
Official Gene Full Name:
Kruppel-like factor 11
Alias Symbols:
NCBI Gene Id:
Protein Name:
Krueppel-like factor 11
Description of Target:
KLF11 (TIEG2) is a pancreas-enriched transcription factor that has elicited significant attention because of its role as negative regulator of exocrine cell growth in vitro and in vivo. It plays a role in the regulation of pancreatic beta cell physiology, and its variants may contribute to the development of diabetes.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KLF11.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KLF11.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...