Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP38365_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38365_P050-FITC Conjugated

ARP38365_P050-HRP Conjugated

ARP38365_P050-Biotin Conjugated

KLF11 Antibody - C-terminal region (ARP38365_P050)

Catalog#: ARP38365_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-136101 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human KLF11
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-KLF11 (ARP38365_P050)
Peptide SequenceSynthetic peptide located within the following region: KFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIP
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-KLF11 (ARP38365_P050) antibody is Catalog # AAP38365 (Previous Catalog # AAPP20551)
Datasheets/ManualsPrintable datasheet for anti-KLF11 (ARP38365_P050) antibody
Target ReferenceHromas,R., (er) J. Clin. Endocrinol. Metab. (2008) In press
Publications

Duncan, J; Wang, N; Zhang, X; Johnson, S; Harris, S; Zheng, B; Zhang, Q; Rajkowska, G; Miguel-Hidalgo, JJ; Sittman, D; Ou, XM; Stockmeier, CA; Wang, JM; Chronic Social Stress and Ethanol Increase Expression of KLF11, a Cell Death Mediator, in Rat Brain. 28, 18-31 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 25739536

Gene SymbolKLF11
Official Gene Full NameKruppel-like factor 11
Alias SymbolsFKLF, FKLF1, MODY7, TIEG2, Tieg3
NCBI Gene Id8462
Protein NameKrueppel-like factor 11
Description of TargetKLF11 (TIEG2) is a pancreas-enriched transcription factor that has elicited significant attention because of its role as negative regulator of exocrine cell growth in vitro and in vivo. It plays a role in the regulation of pancreatic beta cell physiology, and its variants may contribute to the development of diabetes.
Swissprot IdO14901
Protein Accession #NP_003588
Nucleotide Accession #NM_003597
Protein Size (# AA)512
Molecular Weight55kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express KLF11.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express KLF11.
Protein InteractionsAPPBP2; TXNDC9; APH1A; TIMM13; YWHAZ; CLU; SIN3A; MAPK1; ATXN1; CBX5; CBX3; CBX1; EP300; ELAVL1; UBC; HDAC1;
Write Your Own Review
You're reviewing:KLF11 Antibody - C-terminal region (ARP38365_P050)
Your Rating
Free Microscope
Aviva HIS tag Deal
Aviva Travel Grant
Aviva Live Chat