Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP38365_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38365_P050-FITC Conjugated

ARP38365_P050-HRP Conjugated

ARP38365_P050-Biotin Conjugated

KLF11 Antibody - C-terminal region (ARP38365_P050)

Catalog#: ARP38365_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-136101 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human KLF11
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-KLF11 (ARP38365_P050)
Peptide Sequence Synthetic peptide located within the following region: KFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KLF11 (ARP38365_P050) antibody is Catalog # AAP38365 (Previous Catalog # AAPP20551)
Datasheets/Manuals Printable datasheet for anti-KLF11 (ARP38365_P050) antibody
Target Reference Hromas,R., (er) J. Clin. Endocrinol. Metab. (2008) In press
Publications

Duncan, J; Wang, N; Zhang, X; Johnson, S; Harris, S; Zheng, B; Zhang, Q; Rajkowska, G; Miguel-Hidalgo, JJ; Sittman, D; Ou, XM; Stockmeier, CA; Wang, JM; Chronic Social Stress and Ethanol Increase Expression of KLF11, a Cell Death Mediator, in Rat Brain. 28, 18-31 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 25739536

Gene Symbol KLF11
Official Gene Full Name Kruppel-like factor 11
Alias Symbols FKLF, FKLF1, MODY7, TIEG2, Tieg3
NCBI Gene Id 8462
Protein Name Krueppel-like factor 11
Description of Target KLF11 (TIEG2) is a pancreas-enriched transcription factor that has elicited significant attention because of its role as negative regulator of exocrine cell growth in vitro and in vivo. It plays a role in the regulation of pancreatic beta cell physiology, and its variants may contribute to the development of diabetes.
Swissprot Id O14901
Protein Accession # NP_003588
Nucleotide Accession # NM_003597
Protein Size (# AA) 512
Molecular Weight 55kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KLF11.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KLF11.
Protein Interactions APPBP2; TXNDC9; APH1A; TIMM13; YWHAZ; CLU; SIN3A; MAPK1; ATXN1; CBX5; CBX3; CBX1; EP300; ELAVL1; UBC; HDAC1;
  1. What is the species homology for "KLF11 Antibody - C-terminal region (ARP38365_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "KLF11 Antibody - C-terminal region (ARP38365_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KLF11 Antibody - C-terminal region (ARP38365_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KLF11 Antibody - C-terminal region (ARP38365_P050)"?

    This target may also be called "FKLF, FKLF1, MODY7, TIEG2, Tieg3" in publications.

  5. What is the shipping cost for "KLF11 Antibody - C-terminal region (ARP38365_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KLF11 Antibody - C-terminal region (ARP38365_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KLF11 Antibody - C-terminal region (ARP38365_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KLF11 Antibody - C-terminal region (ARP38365_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KLF11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KLF11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KLF11"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KLF11"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KLF11"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KLF11"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KLF11 Antibody - C-terminal region (ARP38365_P050)
Your Rating
We found other products you might like!