KIZ Antibody - C-terminal region (ARP48382_P050)

Catalog No: ARP48382_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-C20orf19 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C20orf19
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Pig: 81%
• Peptide Sequence: Synthetic peptide located within the following region: SRHENKKKPVINLKSNALWDESDDSNSEIEAALRPRNHNTDDSDDFYD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KIZ (ARP48382_P050) antibody is Catalog # AAP48382 (Previous Catalog # AAPY01764)
• Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Target Info

• Gene Symbol: KIZ
• Gene Full Name: kizuna centrosomal protein
• Alias Symbols: RP69, HT013, Kizuna, PLK1S1, C20orf19, NCRNA00153
• NCBI Gene Id: 55857
• Protein Name: centrosomal protein kizuna
• Description of Target: The protein encoded by this gene localizes to centrosomes, strengthening and stabilizing the pericentriolar region prior to spindle formation. The encoded protein usually remains with the mother centrosome after centrosomal duplication. Sevral transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q2M2Z5
• Protein Accession #: NP_060944
• Nucleotide Accession #: NM_018474
• Protein Size (# AA): 673
• Molecular Weight: 75kDa
• Protein Interactions: TACC3; MEOX2; UBD;