SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP44354_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP44354_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

KITLG Antibody - middle region : HRP (ARP44354_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-KITLG (ARP44354_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB, IHC
Additional InformationIHC Information: Placenta
IHC Information: Lung
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human KITLG
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG
Concentration0.5 mg/ml
Blocking PeptideFor anti-KITLG (ARP44354_P050-HRP) antibody is Catalog # AAP44354 (Previous Catalog # AAPS14802)
ReferenceKasamatsu,S., (2008) J. Invest. Dermatol. 128 (7), 1763-1772
Gene SymbolKITLG
Gene Full NameKIT ligand
Alias SymbolsSF, MGF, SCF, SLF, DCUA, FPH2, FPHH, KL-1, Kitl, SHEP7, DFNA69
NCBI Gene Id4254
Protein NameKit ligand
Description of TargetKITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDP21583
Protein Accession #NP_000890
Nucleotide Accession #NM_000899
Protein Size (# AA)273
Molecular Weight28kDa
Protein InteractionsUBC; CLEC11A; UBE2V1; PIK3CD; FLT3LG; KITLG; KIT; CSF2; EPOR; CMA1;
  1. What is the species homology for "KITLG Antibody - middle region : HRP (ARP44354_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep".

  2. How long will it take to receive "KITLG Antibody - middle region : HRP (ARP44354_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KITLG Antibody - middle region : HRP (ARP44354_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KITLG Antibody - middle region : HRP (ARP44354_P050-HRP)"?

    This target may also be called "SF, MGF, SCF, SLF, DCUA, FPH2, FPHH, KL-1, Kitl, SHEP7, DFNA69" in publications.

  5. What is the shipping cost for "KITLG Antibody - middle region : HRP (ARP44354_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KITLG Antibody - middle region : HRP (ARP44354_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KITLG Antibody - middle region : HRP (ARP44354_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KITLG Antibody - middle region : HRP (ARP44354_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KITLG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KITLG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KITLG"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KITLG"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KITLG"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KITLG"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KITLG Antibody - middle region : HRP (ARP44354_P050-HRP)
Your Rating
We found other products you might like!