Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42026_P050 Unconjugated

ARP42026_P050-HRP Conjugated

ARP42026_P050-Biotin Conjugated

KISS1 Antibody : FITC (ARP42026_P050-FITC)

Catalog#: ARP42026_P050-FITC
Domestic: within 1 week delivery | International: 1 week
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTE
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-KISS1 (ARP42026_P050)
Peptide Sequence Synthetic peptide located within the following region: SWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTE
Concentration 0.5 mg/ml
Blocking Peptide Available upon request
Datasheets/Manuals Printable datasheet for anti-KISS1 (ARP42026_P050-FITC) antibody
Gene Symbol KISS1
Official Gene Full Name KiSS-1 metastasis-suppressor
Alias Symbols HH13, KiSS-1,
NCBI Gene Id 3814
Protein Name Metastasis-suppressor KiSS-1
Description of Target This gene is a metastasis suppressor gene that suppresses metastases of melanomas and breast carcinomas without affecting tumorigenicity. The encoded protein may inhibit chemotaxis and invasion and thereby attenuate metastasis in malignant melanomas. Studies suggest a putative role in the regulation of events downstream of cell-matrix adhesion, perhaps involving cytoskeletal reorganization. A protein product of this gene, kisspeptin, stimulates gonadotropin-releasing hormone (GnRH)-induced gonadotropin secretion and regulates the pubertal activation of GnRH nuerons. A polymorphism in the terminal exon of this mRNA results in two protein isoforms. An adenosine present at the polymorphic site represents the third position in a stop codon. When the adenosine is absent, a downstream stop codon is utilized and the encoded protein extends for an additional seven amino acid residues.
Swissprot Id Q15726
Protein Accession # NP_002247
Nucleotide Accession # NM_002256
Protein Size (# AA) 138
Molecular Weight 15 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KISS1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KISS1.
Protein Interactions APP; KISS1R; MMP24; MMP16; MMP14; MMP9; MMP2;
  1. What is the species homology for "KISS1 Antibody : FITC (ARP42026_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "KISS1 Antibody : FITC (ARP42026_P050-FITC)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "KISS1 Antibody : FITC (ARP42026_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "KISS1 Antibody : FITC (ARP42026_P050-FITC)"?

    This target may also be called "HH13, KiSS-1, " in publications.

  5. What is the shipping cost for "KISS1 Antibody : FITC (ARP42026_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KISS1 Antibody : FITC (ARP42026_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KISS1 Antibody : FITC (ARP42026_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "15 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KISS1 Antibody : FITC (ARP42026_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KISS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KISS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KISS1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KISS1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KISS1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KISS1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KISS1 Antibody : FITC (ARP42026_P050-FITC)
Your Rating
We found other products you might like!