Size:100 ul
$125.00
In stock
SKU
ARP42026_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42026_P050 Unconjugated

ARP42026_P050-HRP Conjugated

ARP42026_P050-Biotin Conjugated

KISS1 Antibody : FITC (ARP42026_P050-FITC)

Catalog#: ARP42026_P050-FITC
Domestic: within 1 week delivery International: 1 week
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTE
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-KISS1 (ARP42026_P050)
Peptide Sequence Synthetic peptide located within the following region: SWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTE
Concentration 0.5 mg/ml
Blocking Peptide Available upon request
Datasheets/Manuals Printable datasheet for anti-KISS1 (ARP42026_P050-FITC) antibody
Gene Symbol KISS1
Official Gene Full Name KiSS-1 metastasis-suppressor
Alias Symbols HH13, KiSS-1,
NCBI Gene Id 3814
Protein Name Metastasis-suppressor KiSS-1
Description of Target This gene is a metastasis suppressor gene that suppresses metastases of melanomas and breast carcinomas without affecting tumorigenicity. The encoded protein may inhibit chemotaxis and invasion and thereby attenuate metastasis in malignant melanomas. Studies suggest a putative role in the regulation of events downstream of cell-matrix adhesion, perhaps involving cytoskeletal reorganization. A protein product of this gene, kisspeptin, stimulates gonadotropin-releasing hormone (GnRH)-induced gonadotropin secretion and regulates the pubertal activation of GnRH nuerons. A polymorphism in the terminal exon of this mRNA results in two protein isoforms. An adenosine present at the polymorphic site represents the third position in a stop codon. When the adenosine is absent, a downstream stop codon is utilized and the encoded protein extends for an additional seven amino acid residues.
Swissprot Id Q15726
Protein Accession # NP_002247
Nucleotide Accession # NM_002256
Protein Size (# AA) 138
Molecular Weight 15 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KISS1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KISS1.
Protein Interactions APP; KISS1R; MMP24; MMP16; MMP14; MMP9; MMP2;
Write Your Own Review
You're reviewing:KISS1 Antibody : FITC (ARP42026_P050-FITC)
Your Rating