Search Antibody, Protein, and ELISA Kit Solutions

KISS1 Antibody (ARP42026_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42026_P050-FITC Conjugated

ARP42026_P050-HRP Conjugated

ARP42026_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
The immunogen is a synthetic peptide directed towards the following sequence SWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTE
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-KISS1 (ARP42026_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
Available upon request
Printable datasheet for anti-KISS1 (ARP42026_P050) antibody

Neuropeptide co-expression in hypothalamic kisspeptin neurons of laboratory animals and the human. Front Neurosci. 9, 29 (2015). Human 25713511

Gene Symbol:
Official Gene Full Name:
KiSS-1 metastasis-suppressor
Alias Symbols:
HH13, KiSS-1,
NCBI Gene Id:
Protein Name:
Metastasis-suppressor KiSS-1
Description of Target:
This gene is a metastasis suppressor gene that suppresses metastases of melanomas and breast carcinomas without affecting tumorigenicity. The encoded protein may inhibit chemotaxis and invasion and thereby attenuate metastasis in malignant melanomas. Studies suggest a putative role in the regulation of events downstream of cell-matrix adhesion, perhaps involving cytoskeletal reorganization. A protein product of this gene, kisspeptin, stimulates gonadotropin-releasing hormone (GnRH)-induced gonadotropin secretion and regulates the pubertal activation of GnRH nuerons. A polymorphism in the terminal exon of this mRNA results in two protein isoforms. An adenosine present at the polymorphic site represents the third position in a stop codon. When the adenosine is absent, a downstream stop codon is utilized and the encoded protein extends for an additional seven amino acid residues.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
15 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KISS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KISS1.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...