Size:100 ul
$125.00
In stock
SKU
ARP42026_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42026_P050-FITC Conjugated

ARP42026_P050-HRP Conjugated

ARP42026_P050-Biotin Conjugated

KISS1 Antibody (ARP42026_P050)

Catalog#: ARP42026_P050
Domestic: within 1 week delivery International: 1 week
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTE
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-KISS1 (ARP42026_P050)
Peptide Sequence Synthetic peptide located within the following region: SWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide Available upon request
Datasheets/Manuals Printable datasheet for anti-KISS1 (ARP42026_P050) antibody
Publications

Neuropeptide co-expression in hypothalamic kisspeptin neurons of laboratory animals and the human. Front Neurosci. 9, 29 (2015). Human 25713511

Gene Symbol KISS1
Official Gene Full Name KiSS-1 metastasis-suppressor
Alias Symbols HH13, KiSS-1,
NCBI Gene Id 3814
Protein Name Metastasis-suppressor KiSS-1
Description of Target This gene is a metastasis suppressor gene that suppresses metastases of melanomas and breast carcinomas without affecting tumorigenicity. The encoded protein may inhibit chemotaxis and invasion and thereby attenuate metastasis in malignant melanomas. Studies suggest a putative role in the regulation of events downstream of cell-matrix adhesion, perhaps involving cytoskeletal reorganization. A protein product of this gene, kisspeptin, stimulates gonadotropin-releasing hormone (GnRH)-induced gonadotropin secretion and regulates the pubertal activation of GnRH nuerons. A polymorphism in the terminal exon of this mRNA results in two protein isoforms. An adenosine present at the polymorphic site represents the third position in a stop codon. When the adenosine is absent, a downstream stop codon is utilized and the encoded protein extends for an additional seven amino acid residues.
Swissprot Id Q15726
Protein Accession # NP_002247
Nucleotide Accession # NM_002256
Protein Size (# AA) 138
Molecular Weight 15 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KISS1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KISS1.
Protein Interactions APP; KISS1R; MMP24; MMP16; MMP14; MMP9; MMP2;
Write Your Own Review
You're reviewing:KISS1 Antibody (ARP42026_P050)
Your Rating