Search Antibody, Protein, and ELISA Kit Solutions

KIRREL1 Antibody - middle region (ARP47408_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP47408_P050-FITC Conjugated

ARP47408_P050-HRP Conjugated

ARP47408_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
kirre like nephrin family adhesion molecule 1
NCBI Gene Id:
Protein Name:
kin of IRRE-like protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-27970 from Santa Cruz Biotechnology.
Description of Target:
NEPH1 is a member of the nephrin-like protein family, which includes NEPH2 (MIM 607761) and NEPH3 (MIM 607762). The cytoplasmic domains of these proteins interact with the C terminus of podocin (NPHS2; MIM 604766), and the genes are expressed in kidney podocytes, cells involved in ensuring size- and charge-selective ultrafiltration (Sellin et al., 2003 [PubMed 12424224]).[supplied by OMIM, Mar 2008]
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KIRREL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KIRREL1.
The immunogen is a synthetic peptide directed towards the middle region of human KIRREL
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-KIRREL (ARP47408_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-KIRREL1 (ARP47408_P050) antibody is Catalog # AAP47408 (Previous Catalog # AAPP28273)
Printable datasheet for anti-KIRREL1 (ARP47408_P050) antibody
Target Reference:
Harita,Y., (2008) J. Biol. Chem. 283 (14), 9177-9186

Ito, M. et al. Glycoprotein hyposialylation gives rise to a nephrotic-like syndrome that is prevented by sialic acid administration in GNE V572L point-mutant mice. PLoS One 7, e29873 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22253810

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...