Search Antibody, Protein, and ELISA Kit Solutions

KIR2DS4 Antibody - N-terminal region (ARP81226_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
KIR2DS4
Official Gene Full Name:
killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 4
NCBI Gene Id:
3809
Protein Name:
killer cell immunoglobulin-like receptor 2DS4
Swissprot Id:
P43632
Protein Accession #:
NP_001268900.1
Nucleotide Accession #:
NM_001281971.1
Alias Symbols:
KKA3, KIR1D, NKAT8, CD158I, KIR412, NKAT-8, KIR2DS1, KIR-2DS4
Description of Target:
Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.
Protein Size (# AA):
304
Molecular Weight:
33 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KIR2DS4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KIR2DS4.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human KIR2DS4
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: FLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHRE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KIR2DS4 (ARP81226_P050) antibody is Catalog # AAP81226
Datasheets/Manuals:
Printable datasheet for anti-KIR2DS4 (ARP81226_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...