KIR2DL1 Antibody - C-terminal region (ARP63462_P050)

Catalog No: ARP63462_P050

WB Suggested Anti-KIR2DL1 Antibody
Titration: 1.0 ug/ml
Positive Control: HepG2 Whole Cell

Amount and Sample Type:
Lane 1: 2x107 KIR3DL1 transfected NKL cells IP Antibody:
KIR2DL1 Amount of IP Antibody:
Primary Antibody:
KIR2DL1 Primary Antibody Dilution:
1:250 Secondary Antibody:
Anti-rabbit-HRP Secondary Antibody Dilution:
1:10,000 Gene Name:
KIR2DL1 Submitted by:
Kerry S. Campbell, Institute for Cancer Research.

Amount and Sample Type:
Lane 1: 2x107 KIR2DL1 transfected NKL cells IP Antibody:
KIR2DL1 Amount of IP Antibody:
Primary Antibody:
KIR2DL1 Primary Antibody Dilution:
1:250 Secondary Antibody:
Anti-rabbit-HRP Secondary Antibody Dilution:
1:10,000 Gene Name:
KIR2DL1 Submitted by:
Kerry S. Campbell, Institute for Cancer Research.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IP, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KIR2DL1 (ARP63462_P050) antibody is Catalog # AAP63462

Target Info

• Gene Symbol: KIR2DL1
• Gene Full Name: Killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 1
• Alias Symbols: NKAT, NKAT1, p58.1, CD158A, KIR221, NKAT-1, KIR-K64, KIR2DL3
• NCBI Gene Id: 3802
• Protein Name: Killer cell immunoglobulin-like receptor 2DL1
• Description of Target: Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.
• Uniprot ID: P43626
• Protein Accession #: NP_055033
• Nucleotide Accession #: NM_014218
• Protein Size (# AA): 348
• Molecular Weight: 38kDa
• Protein Interactions: HLA-C;