Size:100 ul
$319.00
In Stock
SKU
ARP33903_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33903_P050-FITC Conjugated

ARP33903_P050-HRP Conjugated

ARP33903_P050-Biotin Conjugated

KIF5B Antibody - N-terminal region (ARP33903_P050)

Catalog#: ARP33903_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Human, Mouse, Pig, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB, IP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human KIF5B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%; Zebrafish: 86%
Complete computational species homology dataAnti-KIF5B (ARP33903_P050)
Peptide SequenceSynthetic peptide located within the following region: CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-KIF5B (ARP33903_P050) antibody is Catalog # AAP33903 (Previous Catalog # AAPP04974)
Datasheets/ManualsPrintable datasheet for anti-KIF5B (ARP33903_P050) antibody
Target ReferenceDiefenbach,R.J., et al., (2004) Biochem. Biophys. Res. Commun. 319 (3), 987-992
Publications

Turner, L. S. et al. Autophagy is increased in prostate cancer cells overexpressing acid ceramidase and enhances resistance to C6 ceramide. Prostate Cancer Prostatic Dis. 14, 30-7 (2011). IHC, WB, Cow, Dog, Human, Mouse, Pig, Rat, Zebrafish 21116286

Gene SymbolKIF5B
Official Gene Full NameKinesin family member 5B
Alias SymbolsKNS, KINH, KNS1, UKHC
NCBI Gene Id3799
Protein NameKinesin-1 heavy chain
Description of TargetKinesin is the founding member of a superfamily of microtubule based motor proteins that perform force-generating tasks such as organelle transport and chromosome segregation. Kinesin consists of heavy and light chains both of which have been documented to bind a variety of potential linker or cargo proteins. KIF5B is an isoform of kinesin heavy chain.
Swissprot IdP33176
Protein Accession #NP_004512
Nucleotide Accession #NM_004521
Protein Size (# AA)963
Molecular Weight110kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express KIF5B.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express KIF5B.
Protein InteractionsZBTB8A; HUWE1; TAX1BP1; VPS52; PRKAR2B; AURKB; STAU1; UBC; TRIM25; EZH2; PSME1; PSMB7; PSMB6; PSMB5; PSMB4; PSMB3; PSMA5; PSMA4; KLC2; SMEK2; RNF20; ELP2; PTPN23; RABGAP1; COPE; AKAP2; COPS5; NUP50; PSMA2; KLC1; EPB41L1; DIAPH1; CAST; ACACA; YWHAE; CFTR;
  1. What is the species homology for "KIF5B Antibody - N-terminal region (ARP33903_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Human, Mouse, Pig, Rat, Zebrafish".

  2. How long will it take to receive "KIF5B Antibody - N-terminal region (ARP33903_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KIF5B Antibody - N-terminal region (ARP33903_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KIF5B Antibody - N-terminal region (ARP33903_P050)"?

    This target may also be called "KNS, KINH, KNS1, UKHC" in publications.

  5. What is the shipping cost for "KIF5B Antibody - N-terminal region (ARP33903_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KIF5B Antibody - N-terminal region (ARP33903_P050)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "KIF5B Antibody - N-terminal region (ARP33903_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "110kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KIF5B Antibody - N-terminal region (ARP33903_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KIF5B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KIF5B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KIF5B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KIF5B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KIF5B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KIF5B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KIF5B Antibody - N-terminal region (ARP33903_P050)
Your Rating
Aviva Tissue Tool
Aviva HIS tag Deal
Aviva ChIP Antibodies
Aviva Blast Tool