Now Offering Over 102,157 Antibodies & 44,722 Antigens!

KIF5B antibody - N-terminal region (ARP33903_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock

Conjugation Options

ARP33903_P050-FITC Conjugated

ARP33903_P050-HRP Conjugated

ARP33903_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
KIF5B
NCBI Gene Id:
3799
Official Gene Full Name:
Kinesin family member 5B
Protein Name:
Kinesin-1 heavy chain
Swissprot Id:
P33176
Protein Accession #:
NP_004512
Nucleotide Accession #:
NM_004521
Alias Symbols:
KNS, KINH, KNS1, UKHC
Description of Target:
Kinesin is the founding member of a superfamily of microtubule based motor proteins that perform force-generating tasks such as organelle transport and chromosome segregation. Kinesin consists of heavy and light chains both of which have been documented to bind a variety of potential linker or cargo proteins. KIF5B is an isoform of kinesin heavy chain.
Protein Size (# AA):
963
Molecular Weight:
110kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KIF5B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KIF5B.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human KIF5B
Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%; Zebrafish: 86%
Complete computational species homology data:
Anti-KIF5B (ARP33903_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ZBTB8A; HUWE1; TAX1BP1; VPS52; PRKAR2B; AURKB; STAU1; UBC; TRIM25; EZH2; PSME1; PSMB7; PSMB6; PSMB5; PSMB4; PSMB3; PSMA5; PSMA4; KLC2; SMEK2; RNF20; ELP2; PTPN23; RABGAP1; COPE; AKAP2; COPS5; NUP50; PSMA2; KLC1; EPB41L1; DIAPH1; CAST; ACACA; YWHAE; CFTR;
Blocking Peptide:
For anti-KIF5B (ARP33903_P050) antibody is Catalog # AAP33903 (Previous Catalog # AAPP04974)
Datasheets/Manuals:
Printable datasheet for anti-KIF5B (ARP33903_P050) antibody
Target Reference:
Diefenbach,R.J., et al., (2004) Biochem. Biophys. Res. Commun. 319 (3), 987-992
Publications:

Turner, L. S. et al. Autophagy is increased in prostate cancer cells overexpressing acid ceramidase and enhances resistance to C6 ceramide. Prostate Cancer Prostatic Dis. 14, 30-7 (2011). IHC, WB, Cow, Dog, Human, Mouse, Pig, Rat, Zebrafish 21116286

Tell us what you think about this item!

Write A Review
    Please, wait...