Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP33908_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33908_P050-FITC Conjugated

ARP33908_P050-HRP Conjugated

ARP33908_P050-Biotin Conjugated

KIF3B Antibody - C-terminal region (ARP33908_P050)

Catalog#: ARP33908_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-136208 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human KIF3B
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-KIF3B (ARP33908_P050)
Peptide Sequence Synthetic peptide located within the following region: APKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSGRKSGSSSSSS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-PARP1 (ARP33908_P050) antibody is Catalog # AAP33908 (Previous Catalog # AAPP04979)
Datasheets/Manuals Printable datasheet for anti-PARP1 (ARP33908_P050) antibody
Target Reference Jimbo,T., et al., (2002) Nat. Cell Biol. 4 (4), 323-327
Publications

Weisschuh, N., Alavi, M. V, Bonin, M. & Wissinger, B. Identification of genes that are linked with optineurin expression using a combined RNAi-microarray approach. Exp. Eye Res. 85, 450-61 (2007). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 17663987

Gene Symbol PARP1
Official Gene Full Name Poly (ADP-ribose) polymerase 1
Alias Symbols PARP, PPOL, ADPRT, ADPRT1, PARP-1, ADPRT 1, pADPRT-1, KIF3B
NCBI Gene Id 142
Protein Name Kinesin-like protein KIF3B
Description of Target The protein encoded by the KIF3B gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved in the intracellular movement of membranous organelles. This protein and kinesin family member 3A form the kinesin II subfamily of the kinesin superfamily.
Swissprot Id O15066
Protein Accession # NP_004789
Nucleotide Accession # NM_004798
Protein Size (# AA) 747
Molecular Weight 85kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KIF3B.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KIF3B.
Protein Interactions PARP1; CASP7; CASP3; UBE2I; TP53; SUMO2; CHFR; BANP; HUWE1; MDM2; SUMO3; DNMT1; CHD1L; IVNS1ABP; DDB2; PARP9; UBC; Rnf146; APLF; UHRF1; RPA3; RPA2; RPA1; ERG; MAFF; POLG2; RPL35; RPL27A; RPL19; RAD23A; PHB; CETN2; CETN1; DDX39A; PDLIM7; RPL14; MAFK; MAFG;
  1. What is the species homology for "KIF3B Antibody - C-terminal region (ARP33908_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "KIF3B Antibody - C-terminal region (ARP33908_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KIF3B Antibody - C-terminal region (ARP33908_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KIF3B Antibody - C-terminal region (ARP33908_P050)"?

    This target may also be called "PARP, PPOL, ADPRT, ADPRT1, PARP-1, ADPRT 1, pADPRT-1, KIF3B" in publications.

  5. What is the shipping cost for "KIF3B Antibody - C-terminal region (ARP33908_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KIF3B Antibody - C-terminal region (ARP33908_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KIF3B Antibody - C-terminal region (ARP33908_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "85kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KIF3B Antibody - C-terminal region (ARP33908_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PARP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PARP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PARP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PARP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PARP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PARP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KIF3B Antibody - C-terminal region (ARP33908_P050)
Your Rating
We found other products you might like!