Search Antibody, Protein, and ELISA Kit Solutions

KIF3B Antibody - C-terminal region (ARP33908_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33908_P050-FITC Conjugated

ARP33908_P050-HRP Conjugated

ARP33908_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Poly (ADP-ribose) polymerase 1
NCBI Gene Id:
Protein Name:
Kinesin-like protein KIF3B
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-136208 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by the KIF3B gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved in the intracellular movement of membranous organelles. This protein and kinesin family member 3A form the kinesin II subfamily of the kinesin superfamily.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KIF3B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KIF3B.
The immunogen is a synthetic peptide directed towards the C terminal region of human KIF3B
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-KIF3B (ARP33908_P050)
Peptide Sequence:
Synthetic peptide located within the following region: APKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSGRKSGSSSSSS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PARP1 (ARP33908_P050) antibody is Catalog # AAP33908 (Previous Catalog # AAPP04979)
Printable datasheet for anti-PARP1 (ARP33908_P050) antibody
Target Reference:
Jimbo,T., et al., (2002) Nat. Cell Biol. 4 (4), 323-327

Weisschuh, N., Alavi, M. V, Bonin, M. & Wissinger, B. Identification of genes that are linked with optineurin expression using a combined RNAi-microarray approach. Exp. Eye Res. 85, 450-61 (2007). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 17663987

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...