KIF2C Antibody - N-terminal region (ARP33915_P050)

Catalog No: ARP33915_P050

WB Suggested Anti-KIF2C Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIF2C
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSELRIT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KIF2C (ARP33915_P050) antibody is Catalog # AAP33915 (Previous Catalog # AAPP04986)
• Reference: Lee,T., (2008) Oncogene 27 (17), 2494-2500

Target Info

• Gene Symbol: KIF2C
• Gene Full Name: Kinesin family member 2C
• Alias Symbols: MCAK, CT139, KNSL6
• NCBI Gene Id: 11004
• Protein Name: Kinesin-like protein KIF2C
• Description of Target: KIF2C is a member of kinesin-like protein family. Proteins of this family are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. It is important for anaphase chromosome segregation and may be required to coordinate the onset of sister centromere separation.The protein encoded by this gene is a member of kinesin-like protein family. Proteins of this family are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein is important for anaphase chromosome segregation and may be required to coordinate the onset of sister centromere separation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q99661
• Protein Accession #: NP_006836
• Nucleotide Accession #: NM_006845
• Protein Size (# AA): 725
• Molecular Weight: 81kDa
• Protein Interactions: UBC; STK4; STK3; FN1; ZNF566; HIST3H3; PAXIP1; APP; VHL; ARRB1; SUMO2; CSNK2B; CENPH; KIF2C; AURKA;