Search Antibody, Protein, and ELISA Kit Solutions

KIF2B Antibody - middle region (ARP34082_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34082_P050-FITC Conjugated

ARP34082_P050-HRP Conjugated

ARP34082_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Kinesin family member 2B
NCBI Gene Id:
Protein Name:
Kinesin-like protein KIF2B
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-146475 from Santa Cruz Biotechnology.
Description of Target:
KIF2B is the plus end-directed microtubule-dependent motor required for spindle assembly and chromosome movement. KIF2B has microtubule depolymerization activity.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KIF2B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KIF2B.
The immunogen is a synthetic peptide directed towards the middle region of human KIF2B
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 85%
Complete computational species homology data:
Anti-KIF2B (ARP34082_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DCSKGIYALVAQDVFLLLRNSTYEKLDLKVYGTFFEIYGGKVYDLLNWKK
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-KIF2B (ARP34082_P050) antibody is Catalog # AAP34082 (Previous Catalog # AAPP23743)
Printable datasheet for anti-KIF2B (ARP34082_P050) antibody
Target Reference:
Manning,A.L., (2007) Mol. Biol. Cell 18 (8), 2970-2979

Shrestha, R. L. & Draviam, V. M. Lateral to end-on conversion of chromosome-microtubule attachment requires kinesins CENP-E and MCAK. Curr. Biol. 23, 1514-26 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23891108

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...