Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP34082_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34082_P050-FITC Conjugated

ARP34082_P050-HRP Conjugated

ARP34082_P050-Biotin Conjugated

KIF2B Antibody - middle region (ARP34082_P050)

Catalog#: ARP34082_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-146475 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KIF2B
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 85%
Complete computational species homology data Anti-KIF2B (ARP34082_P050)
Peptide Sequence Synthetic peptide located within the following region: DCSKGIYALVAQDVFLLLRNSTYEKLDLKVYGTFFEIYGGKVYDLLNWKK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KIF2B (ARP34082_P050) antibody is Catalog # AAP34082 (Previous Catalog # AAPP23743)
Datasheets/Manuals Printable datasheet for anti-KIF2B (ARP34082_P050) antibody
Target Reference Manning,A.L., (2007) Mol. Biol. Cell 18 (8), 2970-2979
Publications

Shrestha, R. L. & Draviam, V. M. Lateral to end-on conversion of chromosome-microtubule attachment requires kinesins CENP-E and MCAK. Curr. Biol. 23, 1514-26 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23891108

Gene Symbol KIF2B
Official Gene Full Name Kinesin family member 2B
Alias Symbols -
NCBI Gene Id 84643
Protein Name Kinesin-like protein KIF2B
Description of Target KIF2B is the plus end-directed microtubule-dependent motor required for spindle assembly and chromosome movement. KIF2B has microtubule depolymerization activity.
Swissprot Id Q8N4N8
Protein Accession # NP_115948
Nucleotide Accession # NM_032559
Protein Size (# AA) 673
Molecular Weight 76kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KIF2B.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KIF2B.
Protein Interactions STAU1;
Write Your Own Review
You're reviewing:KIF2B Antibody - middle region (ARP34082_P050)
Your Rating