KIDINS220 Antibody - middle region (ARP81524_P050)

Catalog No: ARP81524_P050

Host: Rabbit
Target Name: KIDINS220
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIDINS220
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: GPGSTTISGRSSPHSTYYMGQSSSGGSIHSNLEQEKGKDSEPKPDDGRKS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KIDINS220 (ARP81524_P050) antibody is Catalog # AAP81524

Target Info

• Gene Symbol: KIDINS220
• Gene Full Name: kinase D-interacting substrate 220kDa
• Alias Symbols: ARMS, SINO
• NCBI Gene Id: 57498
• Protein Name: kinase D-interacting substrate of 220 kDa
• Description of Target: Promotes a prolonged MAP-kinase signaling by neurotrophins through activation of a Rap1-dependent mechanism. Provides a docking site for the CRKL-C3G complex, resulting in Rap1-dependent sustained ERK activation. May play an important role in regulating postsynaptic signal transduction through the syntrophin-mediated localization of receptor tyrosine kinases such as EPHA4. In cooperation with SNTA1 can enhance EPHA4-induced JAK/STAT activation. Plays a role in nerve growth factor (NGF)-induced recruitment of RAPGEF2 to late endosomes and neurite outgrowth. May play a role in neurotrophin- and ephrin-mediated neuronal outgrowth and in axon guidance during neural development and in neuronal regeneration. Modulates stress-induced apoptosis of melanoma cells via regulation of the MEK/ERK signaling pathway.
• Uniprot ID: Q9ULH0-5
• Protein Accession #: NP_065789.1
• Nucleotide Accession #: NM_020738.2
• Protein Size (# AA): 543
• Molecular Weight: 59 kDa