Search Antibody, Protein, and ELISA Kit Solutions

KIAA0317 antibody - N-terminal region (ARP44874_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44874_P050-FITC Conjugated

ARP44874_P050-HRP Conjugated

ARP44874_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Protein Name:
Protein KIAA0317
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KIAA0317.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KIAA0317.
The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0317
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-KIAA0317 (ARP44874_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LTCGQPHTLQIVPRDEYDNPTNNSMSLRDEHNYTLSIHELGPQEEESTGV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-AREL1 (ARP44874_P050) antibody is Catalog # AAP44874 (Previous Catalog # AAPP25953)
Printable datasheet for anti-AREL1 (ARP44874_P050) antibody
Sample Type Confirmation:

AREL1 is supported by BioGPS gene expression data to be expressed in HT1080


Ubiquitin E3 ligase FIEL1 regulates fibrotic lung injury through SUMO-E3 ligase PIAS4. J Exp Med. 2016 May 30; 213(6): 1029–1046. IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27162139

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

336/12/2018 23:10
  • Overall Experience:
  • Quality:

Submitted By:

Ning Shen

Boston University School of Medicine

 1.       Target Name:


2. Sample types:

Human breast cancer cell lines: BT-549, Hs578T, SUM159PT.

Human triple-negative breast cancer cell lines: BT-549, Hs 578T, MDA-MB-231, SUM159PT.

Human Acute Myeloid Leukemia cell lines: MV-4-11, SKM-1.

3.       Primary antibody dilution:

1:1000 dilution 4 degrees overnight (16 hours)

4.       Secondary antibody dilution:

1:5000 dilution (1 hour room temperature)


The antibody worked well in 4 breast cancer cell lines and 2 AML cell lines in my experiment. And the specificity is also good. 


Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...