Search Antibody, Protein, and ELISA Kit Solutions

KHSRP Antibody - middle region (ARP40474_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40474_P050-FITC Conjugated

ARP40474_P050-HRP Conjugated

ARP40474_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
KH-type splicing regulatory protein
Protein Name:
Far upstream element-binding protein 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-11101, HPA034739
Description of Target:
KHSRP binds to the dendritic targeting element and may play a role in mRNA trafficking. It is part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. KHSRP mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. It may interact with single-stranded DNA from the far-upstream element (FUSE).It is also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly by recruiting degradation machinery to ARE-containing mRNAs.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KHSRP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KHSRP.
The immunogen is a synthetic peptide directed towards the middle region of Human KHSRP
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-KHSRP (ARP40474_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-KHSRP (ARP40474_P050) antibody is Catalog # AAP40474
Printable datasheet for anti-KHSRP (ARP40474_P050) antibody
Sample Type Confirmation:

KHSRP is strongly supported by BioGPS gene expression data to be expressed in HEK293T


Ahn, Y.-H. et al. Electrophilic tuning of the chemoprotective natural product sulforaphane. Proc. Natl. Acad. Sci. U. S. A. 107, 9590-5 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 20439747

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...