Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP40474_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40474_P050-FITC Conjugated

ARP40474_P050-HRP Conjugated

ARP40474_P050-Biotin Conjugated

KHSRP Antibody - middle region (ARP40474_P050)

Catalog#: ARP40474_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-11101, HPA034739
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human KHSRP
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-KHSRP (ARP40474_P050)
Peptide Sequence Synthetic peptide located within the following region: WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KHSRP (ARP40474_P050) antibody is Catalog # AAP40474
Datasheets/Manuals Printable datasheet for anti-KHSRP (ARP40474_P050) antibody
Sample Type Confirmation

KHSRP is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Publications

Ahn, Y.-H. et al. Electrophilic tuning of the chemoprotective natural product sulforaphane. Proc. Natl. Acad. Sci. U. S. A. 107, 9590-5 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 20439747

Gene Symbol KHSRP
Official Gene Full Name KH-type splicing regulatory protein
Alias Symbols FBP2, FUBP2, KSRP, MGC99676
NCBI Gene Id 8570
Protein Name Far upstream element-binding protein 2
Description of Target KHSRP binds to the dendritic targeting element and may play a role in mRNA trafficking. It is part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. KHSRP mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. It may interact with single-stranded DNA from the far-upstream element (FUSE).It is also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly by recruiting degradation machinery to ARE-containing mRNAs.
Swissprot Id Q92945
Protein Accession # NP_003676
Nucleotide Accession # NM_003685
Protein Size (# AA) 711
Molecular Weight 73kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KHSRP.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KHSRP.
Protein Interactions HUWE1; Bace1; UBC; STAU1; LGR4; MDM2; WWOX; SUZ12; EED; RNF2; NAP1L4; HNRNPD; GFPT1; GARS; APBB1; ALDH16A1; TARDBP; CD81; MPG; UBL4A; WHSC1; VCAM1; ITGA4; FN1; STRIP1; ASF1B; CPLX1; CIRBP; SUMO1; RAE1; CAND1; COPS5; CUL1; CUL2; CUL3; CUL4B; CUL5; NEDD8; C
Write Your Own Review
You're reviewing:KHSRP Antibody - middle region (ARP40474_P050)
Your Rating