Search Antibody, Protein, and ELISA Kit Solutions

KHDRBS1 Antibody - middle region (ARP88144_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
KHDRBS1
Official Gene Full Name:
KH domain containing, RNA binding, signal transduction associated 1
NCBI Gene Id:
10657
Protein Name:
KH domain-containing, RNA-binding, signal transduction-associated protein 1
Swissprot Id:
Q07666
Protein Accession #:
NP_001258807.1
Nucleotide Accession #:
NM_001271878.1
Alias Symbols:
p62, p68, Sam68
Description of Target:
This gene encodes a member of the K homology domain-containing, RNA-binding, signal transduction-associated protein family. The encoded protein appears to have many functions and may be involved in a variety of cellular processes, including alternative splicing, cell cycle regulation, RNA 3'-end formation, tumorigenesis, and regulation of human immunodeficiency virus gene expression. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
443
Molecular Weight:
48 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KHDRBS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KHDRBS1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human KHDRBS1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KHDRBS1 (ARP88144_P050) antibody is Catalog # AAP88144
Datasheets/Manuals:
Printable datasheet for anti-KHDRBS1 (ARP88144_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...