Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
SKU
ARP34728_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34728_T100-FITC Conjugated

ARP34728_T100-HRP Conjugated

ARP34728_T100-Biotin Conjugated

KEAP1 Antibody - C-terminal region (ARP34728_T100)

Catalog#: ARP34728_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-15244 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human KEAP1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-KEAP1 (ARP34728_T100)
Peptide Sequence Synthetic peptide located within the following region: TWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KEAP1 (ARP34728_T100) antibody is Catalog # AAP34728 (Previous Catalog # AAPP23660)
Datasheets/Manuals Printable datasheet for anti-KEAP1 (ARP34728_T100) antibody
Sample Type Confirmation

KEAP1 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Padmanabhan,B., (2006) Mol. Cell 21 (5), 689-700
Publications

Konishi, M; Baumgarten, A; Ishida, J; Saitoh, M; Anker, SD; Springer, J; Protein levels in Keap1-Nrf2 system in human failing heart. 225, 62-64 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27710805

Gene Symbol KEAP1
Official Gene Full Name Kelch-like ECH-associated protein 1
Alias Symbols INrf2, KIAA0132, KLHL19, MGC10630, MGC1114, MGC20887, MGC4407, MGC9454
NCBI Gene Id 9817
Protein Name Kelch-like ECH-associated protein 1
Description of Target KEAP1 contains KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase.This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.
Swissprot Id Q14145
Protein Accession # NP_987096
Nucleotide Accession # NM_203500
Protein Size (# AA) 624
Molecular Weight 70kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KEAP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KEAP1.
Protein Interactions OXR1; ZSCAN32; LSM3; KLHL3; FBXW11; MAPKBP1; NUDT4; DPP3; RBX1; ATG5; SQSTM1; PTMA; PRKAG1; NFE2L2; MAD2L1; GYPA; ETF1; BCL2; CUL3; RECK; UBC; PGAM5; FAM117B; WDR83; CCNB1IP1; HSP90AA1; XPO1; MCMBP; KEAP1; SLK; MCM3; IKBKB; AMER1; GPRASP2; PRKCE; NFE2L1;
  1. What is the species homology for "KEAP1 Antibody - C-terminal region (ARP34728_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "KEAP1 Antibody - C-terminal region (ARP34728_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KEAP1 Antibody - C-terminal region (ARP34728_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KEAP1 Antibody - C-terminal region (ARP34728_T100)"?

    This target may also be called "INrf2, KIAA0132, KLHL19, MGC10630, MGC1114, MGC20887, MGC4407, MGC9454" in publications.

  5. What is the shipping cost for "KEAP1 Antibody - C-terminal region (ARP34728_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KEAP1 Antibody - C-terminal region (ARP34728_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KEAP1 Antibody - C-terminal region (ARP34728_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "70kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KEAP1 Antibody - C-terminal region (ARP34728_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KEAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KEAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KEAP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KEAP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KEAP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KEAP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KEAP1 Antibody - C-terminal region (ARP34728_T100)
Your Rating
We found other products you might like!