Search Antibody, Protein, and ELISA Kit Solutions

KEAP1 Antibody - C-terminal region (ARP34728_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34728_T100-FITC Conjugated

ARP34728_T100-HRP Conjugated

ARP34728_T100-Biotin Conjugated

Gene Symbol:
KEAP1
Official Gene Full Name:
Kelch-like ECH-associated protein 1
NCBI Gene Id:
9817
Protein Name:
Kelch-like ECH-associated protein 1
Swissprot Id:
Q14145
Protein Accession #:
NP_987096
Nucleotide Accession #:
NM_203500
Alias Symbols:
INrf2, KIAA0132, KLHL19, MGC10630, MGC1114, MGC20887, MGC4407, MGC9454
Replacement Item:
This antibody may replace item sc-15244 from Santa Cruz Biotechnology.
Description of Target:
KEAP1 contains KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase.This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.
Protein Size (# AA):
624
Molecular Weight:
70kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KEAP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KEAP1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human KEAP1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-KEAP1 (ARP34728_T100)
Peptide Sequence:
Synthetic peptide located within the following region: TWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
OXR1; ZSCAN32; LSM3; KLHL3; FBXW11; MAPKBP1; NUDT4; DPP3; RBX1; ATG5; SQSTM1; PTMA; PRKAG1; NFE2L2; MAD2L1; GYPA; ETF1; BCL2; CUL3; RECK; UBC; PGAM5; FAM117B; WDR83; CCNB1IP1; HSP90AA1; XPO1; MCMBP; KEAP1; SLK; MCM3; IKBKB; AMER1; GPRASP2; PRKCE; NFE2L1;
Blocking Peptide:
For anti-KEAP1 (ARP34728_T100) antibody is Catalog # AAP34728 (Previous Catalog # AAPP23660)
Datasheets/Manuals:
Printable datasheet for anti-KEAP1 (ARP34728_T100) antibody
Sample Type Confirmation:

KEAP1 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Padmanabhan,B., (2006) Mol. Cell 21 (5), 689-700
Publications:

Konishi, M; Baumgarten, A; Ishida, J; Saitoh, M; Anker, SD; Springer, J; Protein levels in Keap1-Nrf2 system in human failing heart. 225, 62-64 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27710805

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...