Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

KDM5B Antibody - C-terminal region : FITC (ARP72851_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72851_P050 Unconjugated

ARP72851_P050-HRP Conjugated

ARP72851_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
KDM5B
NCBI Gene Id:
10765
Swissprot Id:
Q9UGL1
Protein Accession #:
NP_006609
Alias Symbols:
KDM5B, JARID1B, PLU1, RBBP2H1,
Description of Target:
KDM5B is a histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. It does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. KDM5B demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. It acts as a transcriptional corepressor for FOXG1B and PAX9. It favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, KDM5B may act as a tumor suppressor for melanoma.
Protein Size (# AA):
1544
Molecular Weight:
169kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KDM5B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KDM5B.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KDM5B
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: EMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
FBXW11; UBC; HDAC2; HDAC4; SUMO1; SUMO3; PPP1CA; TFAP2C; MYC; HDAC7; HDAC5; NCOR1; PAX9; HDAC1; ELAVL1; CHD3; MTA3; MBD3; KDM1A; MTA2; MBD2; RBBP7; RBBP4; RB1; SUMO2; KLF10; LMO2; FOXG1; AR; VGLL3; PRDM13; ARID1B; BMP2K; RNF43; RBM15B; DBNL; CECR6; SLC39A
Blocking Peptide:
For anti-KDM5B (ARP72851_P050-FITC) antibody is Catalog # AAP72851
Datasheets/Manuals:
Printable datasheet for anti-KDM5B (ARP72851_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...