Search Antibody, Protein, and ELISA Kit Solutions

KDM4C Antibody - C-terminal region : FITC (ARP75437_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75437_P050 Unconjugated

ARP75437_P050-HRP Conjugated

ARP75437_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-104949 from Santa Cruz Biotechnology.
Description of Target:
This gene is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein with one JmjC domain, one JmjN domain, two PHD-type zinc fingers, and two Tudor domains. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form. Chromosomal aberrations and increased transcriptional expression of this gene are associated with esophageal squamous cell carcinoma. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KDM4C.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KDM4C.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KDM4C
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: LMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-KDM4C (ARP75437_P050-FITC) antibody is Catalog # AAP75437
Printable datasheet for anti-KDM4C (ARP75437_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...