KDM4B Antibody - N-terminal region : Biotin (ARP75429_P050-Biotin)

Catalog No: ARP75429_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KDM4B
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: IPPKEWKPRQTYDDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KDM4B (ARP75429_P050-Biotin) antibody is Catalog # AAP75429
• Reference: N/A

Target Info

• Gene Symbol: KDM4B
• Alias Symbols: JMJD2B, TDRD14B
• NCBI Gene Id: 23030
• Description of Target: KDM4B is a histone demethylase that specifically demethylates 'Lys- 9' of histone H3, thereby playing a role in histone code. It does not demethylate histone H3 'Lys-4', H3 'Lys-27', H3 'Lys-36' nor H4 'Lys-20'. Only able to demethylate trimethylated H3 'Lys-9', with a weaker activity than KDM4A, KDM4C and KDM4D. Demethylation of Lys residue generates formaldehyde and succinate.
• Uniprot ID: O94953
• Protein Accession #: NP_055830
• Protein Size (# AA): 1096
• Molecular Weight: 120kDa
• Protein Interactions: UBC; H3F3C; HSP90B1; HSP90AA2P; SMU1; KMT2C; WDR5; ASH2L; KMT2D; RBBP5; HSPA4; HNRNPU; ESR1; MED10;