Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP35296_P050
Price: $0.00
SKU
ARP35296_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

KCNQ5 Antibody - C-terminal region (ARP35296_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-KCNQ5 (ARP35296_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human KCNQ5
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: ELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEETETDTFDAAP
Concentration0.5 mg/ml
Blocking PeptideFor anti-KCNQ5 (ARP35296_P050) antibody is Catalog # AAP35296
Gene SymbolKCNQ5
Gene Full Namepotassium voltage-gated channel subfamily Q member 5
Alias SymbolsKv7.5, MRD46
NCBI Gene Id56479
Protein NamePotassium voltage-gated channel subfamily KQT member 5
Description of TargetThis gene is a member of the KCNQ potassium channel gene family that is differentially expressed in subregions of the brain and in skeletal muscle. The protein encoded by this gene yields currents that activate slowly with depolarization and can form heteromeric channels with the protein encoded by the KCNQ3 gene. Currents expressed from this protein have voltage dependences and inhibitor sensitivities in common with M-currents. They are also inhibited by M1 muscarinic receptor activation. Multiple transcript variants encoding different isoforms have been found for this gene.
Uniprot IDQ9NR82-3
Protein Accession #NP_062816
Nucleotide Accession #NM_019842.3
Protein Size (# AA)942
Molecular Weight103 kDa
Protein InteractionsKCNQ5; KCNQ3; DISC1; SRC; CALM3; CALM1;
  1. What is the species homology for "KCNQ5 Antibody - C-terminal region (ARP35296_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "KCNQ5 Antibody - C-terminal region (ARP35296_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "KCNQ5 Antibody - C-terminal region (ARP35296_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KCNQ5 Antibody - C-terminal region (ARP35296_P050)"?

    This target may also be called "Kv7.5, MRD46" in publications.

  5. What is the shipping cost for "KCNQ5 Antibody - C-terminal region (ARP35296_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KCNQ5 Antibody - C-terminal region (ARP35296_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KCNQ5 Antibody - C-terminal region (ARP35296_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "103 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KCNQ5 Antibody - C-terminal region (ARP35296_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KCNQ5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KCNQ5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KCNQ5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KCNQ5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KCNQ5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KCNQ5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KCNQ5 Antibody - C-terminal region (ARP35296_P050)
Your Rating
We found other products you might like!