Size:100 ul
$249.00
In Stock
SKU
ARP35459_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35459_T100-FITC Conjugated

ARP35459_T100-HRP Conjugated

ARP35459_T100-Biotin Conjugated

KCNQ2 Antibody - middle region (ARP35459_T100)

Catalog#: ARP35459_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-128912 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KCNQ2
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-KCNQ2 (ARP35459_T100)
Peptide Sequence Synthetic peptide located within the following region: GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KCNQ2 (ARP35459_T100) antibody is Catalog # AAP35459 (Previous Catalog # AAPP07278)
Datasheets/Manuals Printable datasheet for anti-KCNQ2 (ARP35459_T100) antibody
Target Reference Tang,B., et al., (2004) J. Neurol. Sci. 221 (1-2), 31-34
Publications

Zhang, H. et al. Membrane microdomain determines the specificity of receptor-mediated modulation of Kv7/M potassium currents. Neuroscience 254, 70-9 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24036375

Gene Symbol KCNQ2
Official Gene Full Name Potassium voltage-gated channel, KQT-like subfamily, member 2
Alias Symbols EBN, BFNC, EBN1, ENB1, BFNS1, EIEE7, HNSPC, KV7.2, KCNA11, KVEBN1
NCBI Gene Id 3785
Description of Target The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by the KCNQ2 gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).
Swissprot Id Q5VYU0
Protein Accession # NP_742107
Nucleotide Accession # NM_172109
Protein Size (# AA) 393
Molecular Weight 43kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KCNQ2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KCNQ2.
Protein Interactions ARIH2; KCNQ3; PRKCA; CALM3; CALM1; CALM2; KCNQ1;
  1. What is the species homology for "KCNQ2 Antibody - middle region (ARP35459_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "KCNQ2 Antibody - middle region (ARP35459_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KCNQ2 Antibody - middle region (ARP35459_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KCNQ2 Antibody - middle region (ARP35459_T100)"?

    This target may also be called "EBN, BFNC, EBN1, ENB1, BFNS1, EIEE7, HNSPC, KV7.2, KCNA11, KVEBN1" in publications.

  5. What is the shipping cost for "KCNQ2 Antibody - middle region (ARP35459_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KCNQ2 Antibody - middle region (ARP35459_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KCNQ2 Antibody - middle region (ARP35459_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KCNQ2 Antibody - middle region (ARP35459_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KCNQ2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KCNQ2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KCNQ2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KCNQ2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KCNQ2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KCNQ2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KCNQ2 Antibody - middle region (ARP35459_T100)
Your Rating
We found other products you might like!