KCNQ2 Antibody - middle region (ARP35459_T100)

Catalog#: ARP35459_T100

• Size: 100 ul

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Gene Symbol: KCNQ2
• Official Gene Full Name: Potassium voltage-gated channel, KQT-like subfamily, member 2
• NCBI Gene Id: 3785
• Swissprot Id: Q5VYU0
• Protein Accession #: NP_742107
• Nucleotide Accession #: NM_172109
• Alias Symbols: EBN, BFNC, EBN1, ENB1, BFNS1, EIEE7, HNSPC, KV7.2, KCNA11, KVEBN1
• Replacement Item: This antibody may replace item sc-128912 from Santa Cruz Biotechnology.
• Description of Target: The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by the KCNQ2 gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).
• Protein Size (# AA): 393
• Molecular Weight: 43kDa
• Purification: Protein A purified
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express KCNQ2.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNQ2
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Protein Interactions: ARIH2; KCNQ3; PRKCA; CALM3; CALM1; CALM2; KCNQ1;
• Blocking Peptide: For anti-KCNQ2 (ARP35459_T100) antibody is Catalog # AAP35459 (Previous Catalog # AAPP07278)
• Target Reference: Tang,B., et al., (2004) J. Neurol. Sci. 221 (1-2), 31-34
• Publications:

  Zhang, H. et al. Membrane microdomain determines the specificity of receptor-mediated modulation of Kv7/M potassium currents. Neuroscience 254, 70-9 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24036375

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: KCNQ2 antibody tested with Human Hepg2 Cells (ARP35459_T100)

Product Protocols: KCNQ2 antibody tested by IHC with human kidney (ARP35459)