Size:100 ul
$249.00
In stock
SKU
ARP35459_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35459_T100-FITC Conjugated

ARP35459_T100-HRP Conjugated

ARP35459_T100-Biotin Conjugated

KCNQ2 Antibody - middle region (ARP35459_T100)

Catalog#: ARP35459_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-128912 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KCNQ2
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-KCNQ2 (ARP35459_T100)
Peptide Sequence Synthetic peptide located within the following region: GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KCNQ2 (ARP35459_T100) antibody is Catalog # AAP35459 (Previous Catalog # AAPP07278)
Datasheets/Manuals Printable datasheet for anti-KCNQ2 (ARP35459_T100) antibody
Target Reference Tang,B., et al., (2004) J. Neurol. Sci. 221 (1-2), 31-34
Publications

Zhang, H. et al. Membrane microdomain determines the specificity of receptor-mediated modulation of Kv7/M potassium currents. Neuroscience 254, 70-9 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24036375

Gene Symbol KCNQ2
Official Gene Full Name Potassium voltage-gated channel, KQT-like subfamily, member 2
Alias Symbols EBN, BFNC, EBN1, ENB1, BFNS1, EIEE7, HNSPC, KV7.2, KCNA11, KVEBN1
NCBI Gene Id 3785
Description of Target The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by the KCNQ2 gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).
Swissprot Id Q5VYU0
Protein Accession # NP_742107
Nucleotide Accession # NM_172109
Protein Size (# AA) 393
Molecular Weight 43kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KCNQ2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KCNQ2.
Protein Interactions ARIH2; KCNQ3; PRKCA; CALM3; CALM1; CALM2; KCNQ1;
Write Your Own Review
You're reviewing:KCNQ2 Antibody - middle region (ARP35459_T100)
Your Rating