Search Antibody, Protein, and ELISA Kit Solutions

KCNQ2 Antibody - middle region (ARP35459_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35459_T100-FITC Conjugated

ARP35459_T100-HRP Conjugated

ARP35459_T100-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-128912 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human KCNQ2
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-KCNQ2 (ARP35459_T100)
Peptide Sequence:
Synthetic peptide located within the following region: GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KCNQ2 (ARP35459_T100) antibody is Catalog # AAP35459 (Previous Catalog # AAPP07278)
Printable datasheet for anti-KCNQ2 (ARP35459_T100) antibody
Target Reference:
Tang,B., et al., (2004) J. Neurol. Sci. 221 (1-2), 31-34

Zhang, H. et al. Membrane microdomain determines the specificity of receptor-mediated modulation of Kv7/M potassium currents. Neuroscience 254, 70-9 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24036375

Gene Symbol:
Official Gene Full Name:
Potassium voltage-gated channel, KQT-like subfamily, member 2
Alias Symbols:
NCBI Gene Id:
Description of Target:
The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by the KCNQ2 gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KCNQ2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KCNQ2.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...