Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP34924_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34924_P050-FITC Conjugated

ARP34924_P050-HRP Conjugated

ARP34924_P050-Biotin Conjugated

KCNQ1 Antibody - N-terminal region (ARP34924_P050)

Catalog#: ARP34924_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse, Hamster
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Kidney
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-10645 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human KCNQ1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology dataAnti-KCNQ1 (ARP34924_P050)
Peptide SequenceSynthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-KCNQ1 (ARP34924_P050) antibody is Catalog # AAP34924 (Previous Catalog # AAPP06102)
Datasheets/ManualsPrintable datasheet for anti-KCNQ1 (ARP34924_P050) antibody
Publications

Zhou, S. et al. Antiarrhythmic effects of beta3-adrenergic receptor stimulation in a canine model of ventricular tachycardia. Heart Rhythm 5, 289-97 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18242556

Gene SymbolKCNQ1
Official Gene Full NamePotassium voltage-gated channel, KQT-like subfamily, member 1
Alias SymbolsATFB1, FLJ26167, JLNS1, KCNA8, KCNA9, KVLQT1, Kv1.9, Kv7.1, LQT, LQT1, RWS, SQT2, WRS, ATFB3
NCBI Gene Id3784
Description of TargetVoltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This gene is abundantly expressed in skeletal muscle. Alternative splicing results in at least two transcript variants encoding distinct isoforms.
Swissprot IdP51787
Protein Accession #NP_861462
Nucleotide Accession #NM_181797
Protein Size (# AA)586
Molecular Weight64kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express KCNQ1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express KCNQ1.
Protein InteractionsATP4A; NEDD4L; AP2M1; USP2; UBC; NEDD4; PRKACA; KCNE1; HSPA4; KCNE4; AKAP9; KCNE2; TRAF6; KCNQ2; PRKAR2A; PPP1CA;
Write Your Own Review
You're reviewing:KCNQ1 Antibody - N-terminal region (ARP34924_P050)
Your Rating
Free Microscope
Aviva ChIP Antibodies
Aviva Tips and Tricks
Aviva Live Chat