Search Antibody, Protein, and ELISA Kit Solutions

KCNQ1 Antibody - N-terminal region (ARP34924_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34924_P050-FITC Conjugated

ARP34924_P050-HRP Conjugated

ARP34924_P050-Biotin Conjugated

Gene Symbol:
KCNQ1
Official Gene Full Name:
Potassium voltage-gated channel, KQT-like subfamily, member 1
NCBI Gene Id:
3784
Swissprot Id:
P51787
Protein Accession #:
NP_861462
Nucleotide Accession #:
NM_181797
Alias Symbols:
ATFB1, FLJ26167, JLNS1, KCNA8, KCNA9, KVLQT1, Kv1.9, Kv7.1, LQT, LQT1, RWS, SQT2, WRS, ATFB3
Replacement Item:
This antibody may replace item sc-10645 from Santa Cruz Biotechnology.
Description of Target:
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This gene is abundantly expressed in skeletal muscle. Alternative splicing results in at least two transcript variants encoding distinct isoforms.
Protein Size (# AA):
586
Molecular Weight:
64kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KCNQ1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KCNQ1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNQ1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human, Mouse, Hamster
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-KCNQ1 (ARP34924_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ATP4A; NEDD4L; AP2M1; USP2; UBC; NEDD4; PRKACA; KCNE1; HSPA4; KCNE4; AKAP9; KCNE2; TRAF6; KCNQ2; PRKAR2A; PPP1CA;
Blocking Peptide:
For anti-KCNQ1 (ARP34924_P050) antibody is Catalog # AAP34924 (Previous Catalog # AAPP06102)
Datasheets/Manuals:
Printable datasheet for anti-KCNQ1 (ARP34924_P050) antibody
Additional Information:
IHC Information: Kidney
Publications:

Zhou, S. et al. Antiarrhythmic effects of beta3-adrenergic receptor stimulation in a canine model of ventricular tachycardia. Heart Rhythm 5, 289-97 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18242556

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...