Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

KCNN2 antibody - middle region (ARP35439_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP35439_P050-FITC Conjugated

ARP35439_P050-HRP Conjugated

ARP35439_P050-Biotin Conjugated

Gene Symbol:
KCNN2
NCBI Gene Id:
3781
Official Gene Full Name:
Potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2
Protein Name:
Potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 EMBL AAH15371.1
Swissprot Id:
Q6PJI0
Protein Accession #:
NP_740721
Nucleotide Accession #:
NM_170775
Alias Symbols:
KCa2.2, SK2, SKCA2, hSK2
Replacement Item:
This antibody may replace item sc-101991 from Santa Cruz Biotechnology.
Description of Target:
KCNN2 is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This protein is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for KCNN2.Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP.Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by this gene is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This gene is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
231
Molecular Weight:
26kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KCNN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KCNN2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human KCNN2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-KCNN2 (ARP35439_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SRPK2; SRPK1; UBC; ACTN2; KCNN2; CALM1;
Blocking Peptide:
For anti-KCNN2 (ARP35439_P050) antibody is Catalog # AAP35439 (Previous Catalog # AAPP06677)
Datasheets/Manuals:
Printable datasheet for anti-KCNN2 (ARP35439_P050) antibody
Target Reference:
Morimoto,T., (2007) J. Pharmacol. Sci. 104 (1), 94-98
Publications:

Chakroborty, S. et al. Early presynaptic and postsynaptic calcium signaling abnormalities mask underlying synaptic depression in presymptomatic Alzheimer’s disease mice. J. Neurosci. 32, 8341-53 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22699914

Tell us what you think about this item!

Write A Review
    Please, wait...