Search Antibody, Protein, and ELISA Kit Solutions

KCNN2 Antibody - middle region (ARP35439_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35439_P050-FITC Conjugated

ARP35439_P050-HRP Conjugated

ARP35439_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Monkey
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-101991 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human KCNN2
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-KCNN2 (ARP35439_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KCNN2 (ARP35439_P050) antibody is Catalog # AAP35439 (Previous Catalog # AAPP06677)
Printable datasheet for anti-KCNN2 (ARP35439_P050) antibody
Target Reference:
Morimoto,T., (2007) J. Pharmacol. Sci. 104 (1), 94-98

Chakroborty, S. et al. Early presynaptic and postsynaptic calcium signaling abnormalities mask underlying synaptic depression in presymptomatic Alzheimer’s disease mice. J. Neurosci. 32, 8341-53 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22699914

Gene Symbol:
Official Gene Full Name:
Potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2
Alias Symbols:
KCa2.2, SK2, SKCA2, hSK2
NCBI Gene Id:
Protein Name:
Potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 EMBL AAH15371.1
Description of Target:
KCNN2 is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This protein is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for KCNN2.Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP.Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by this gene is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This gene is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for this gene.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KCNN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KCNN2.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...