Size:100 ul
$319.00
In stock
SKU
ARP35439_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35439_P050-FITC Conjugated

ARP35439_P050-HRP Conjugated

ARP35439_P050-Biotin Conjugated

More Information
Tested Species ReactivityHuman, Monkey
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-101991 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human KCNN2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology dataAnti-KCNN2 (ARP35439_P050)
Peptide SequenceSynthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-KCNN2 (ARP35439_P050) antibody is Catalog # AAP35439 (Previous Catalog # AAPP06677)
Datasheets/ManualsPrintable datasheet for anti-KCNN2 (ARP35439_P050) antibody
Target ReferenceMorimoto,T., (2007) J. Pharmacol. Sci. 104 (1), 94-98
Publications

Chakroborty, S. et al. Early presynaptic and postsynaptic calcium signaling abnormalities mask underlying synaptic depression in presymptomatic Alzheimer’s disease mice. J. Neurosci. 32, 8341-53 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22699914

Gene SymbolKCNN2
Official Gene Full NamePotassium intermediate/small conductance calcium-activated channel, subfamily N, member 2
Alias SymbolsKCa2.2, SK2, SKCA2, hSK2
NCBI Gene Id3781
Protein NamePotassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 EMBL AAH15371.1
Description of TargetKCNN2 is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This protein is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for KCNN2.Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP.Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by this gene is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This gene is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for this gene.
Swissprot IdQ6PJI0
Protein Accession #NP_740721
Nucleotide Accession #NM_170775
Protein Size (# AA)231
Molecular Weight26kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express KCNN2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express KCNN2.
Protein InteractionsSRPK2; SRPK1; UBC; ACTN2; KCNN2; CALM1;
Write Your Own Review
You're reviewing:KCNN2 Antibody - middle region (ARP35439_P050)
Your Rating
Aviva ChIP Antibodies
Aviva Travel Grant
Aviva Tissue Tool
Aviva Live Chat