KCNN2 Antibody - C-terminal region : HRP (ARP35094_T100-HRP)

Catalog No: ARP35094_T100-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KCNN2
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KCNN2 (ARP35094_T100-HRP) antibody is Catalog # AAP35094 (Previous Catalog # AAPP06325)
• Reference: Feranchak,A.P., et al., (2004) Gastroenterology 127 (3), 903-913
• Publications:

  Chakroborty, S. et al. Early presynaptic and postsynaptic calcium signaling abnormalities mask underlying synaptic depression in presymptomatic Alzheimer's disease mice. J. Neurosci. 32, 8341-53 (2012). WB, IHC, Human, Yeast, Zebrafish, Mouse, Rat, Bovine, Dog, Pig, Horse, Rabbit, Guinea pig 22699914

Target Info

• Gene Symbol: KCNN2
• Gene Full Name: Potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2
• Alias Symbols: SK2, hSK2, SKCA2, KCa2.2, SKCa 2
• NCBI Gene Id: 3781
• Protein Name: Small conductance calcium-activated potassium channel protein 2
• Description of Target: Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. KCNN2 is a member of the KCNN family of potassium channel genes.
• Uniprot ID: Q9H2S1
• Protein Accession #: NP_067627
• Nucleotide Accession #: NM_021614
• Protein Size (# AA): 579
• Molecular Weight: 64kDa
• Protein Interactions: SRPK2; SRPK1; UBC; ACTN2; KCNN2; CALM1;