Now Offering Over 102,157 Antibodies & 44,722 Antigens!

KCNN2 antibody - C-terminal region (ARP35094_T100)

100 ul
$249.00
In Stock

Conjugation Options

ARP35094_T100-FITC Conjugated

ARP35094_T100-HRP Conjugated

ARP35094_T100-Biotin Conjugated

Gene Symbol:
KCNN2
NCBI Gene Id:
3781
Official Gene Full Name:
Potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2
Protein Name:
Small conductance calcium-activated potassium channel protein 2
Swissprot Id:
Q9H2S1
Protein Accession #:
NP_067627
Nucleotide Accession #:
NM_021614
Alias Symbols:
SK2, hSK2, SKCA2, KCa2.2
Replacement Item:
This antibody may replace item sc-101991 from Santa Cruz Biotechnology.
Description of Target:
Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. KCNN2 is a member of the KCNN family of potassium channel genes.
Protein Size (# AA):
579
Molecular Weight:
64kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KCNN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KCNN2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human KCNN2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish, Monkey
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-KCNN2 (ARP35094_T100)
Peptide Sequence:
Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SRPK2; SRPK1; UBC; ACTN2; KCNN2; CALM1;
Blocking Peptide:
For anti-KCNN2 (ARP35094_T100) antibody is Catalog # AAP35094 (Previous Catalog # AAPP06325)
Datasheets/Manuals:
Printable datasheet for anti-KCNN2 (ARP35094_T100) antibody
Target Reference:
Feranchak,A.P., et al., (2004) Gastroenterology 127 (3), 903-913
Publications:

Chakroborty, S. et al. Early presynaptic and postsynaptic calcium signaling abnormalities mask underlying synaptic depression in presymptomatic Alzheimer’s disease mice. J. Neurosci. 32, 8341-53 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish, Monkey 22699914

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: KCNN2 antibody - C-terminal region (ARP35094_T100) in Rat brain section using IHC
Product page for KCNN2 antibody - C-terminal region (ARP35094_T100)

Researcher: Dr. Amiel Rosenkranz, Rosalind Franklin University
Application: IHC
Species + Tissue/Cell type: Rat brain section
Primary antibody dilution: 1:500
Secondary antibody: Anti-rabbit-biotin, streptavidin-diaminobenzidine
Secondary antibody dilution: 1:500


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? To direct our electrophysiology studies
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4-good stainning with little background
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes. It looks like the stain is discrete enough to allow quantification.
How did you store the antibody after re-suspension? 4 dgrees C
Sample Description (please include species type and tissue/cell type): Rat, Sprague-Dawley, brain
Please explain fixation solution/method used (formalin, periodate-lysine-paraformaldehyde, acetone, etc.)? Rat perfused with 4% parafolmaldehyde, brain stored in 4% parafolmaldehyde, transferred to 15% sucrose
How many different experimental trials were conducted using the antibody sample? 2
Primary antibody dilution, incubation time and temperature: 1:200, 1:500, 1:1000, 1:2000; 48 hours, 4 degrees C
Secondary antibody used, dilution, incubation time and temperature: 1:500 biotinylated anti-rabbit
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: purple - diaminobenzidine for secondary antibody
Did you use an antigen retrieval method? If so, please explain? No
What controls were used in your experiment? Same protocol without primary antibody
Please include your detailed tissue preparation and staining procedure/protocol here:  -Section washed in 0.1 M PBS (3x10 m)
-washed in 0.03% H2O2 in 0.1 M PBS (10 m)
-washed in 0.1 M PBS (3x10 m)
-incubated in 1% donkey serum + 0.1% Triton-X in, 0.1 M PBS (60 m), then washed (as above)
- -incubated at 4C in primary antibody + 1% donkey serum + 0.1% Triton-X in, 0.1 M PBS (48 hrs)
-washed (as above)
-incubated at RT in ABC (Vector Laboratories, 2hrs)
-washed in 0.05 M Tris-HCL (3x10 m)
-incubated in DAB (DAB+urea/H2O2) in 0.05 M Tris-HCL (5-15 m)
-washed in 0.05 M Tris-HCL (3 x10 m) and mounted
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...