Search Antibody, Protein, and ELISA Kit Solutions

KCNMA1 Antibody - C-terminal (ARP35092_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35092_P050-FITC Conjugated

ARP35092_P050-HRP Conjugated

ARP35092_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Potassium large conductance calcium-activated channel, subfamily M, alpha member 1
NCBI Gene Id:
Protein Name:
Calcium-activated potassium channel subunit alpha-1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
BKTM, DKFZp686K1437, KCa1.1, MGC71881, MaxiK, SAKCA, SLO, SLO-ALPHA, mSLO1, SLO1, bA205K10.1
Replacement Item:
This antibody may replace item sc-14746 from Santa Cruz Biotechnology.
Description of Target:
MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits.MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KCNMA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KCNMA1.
The immunogen is a synthetic peptide directed towards the c terminal region of human KCNMA1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-KCNMA1 (ARP35092_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-KCNMA1 (ARP35092_P050) antibody is Catalog # AAP35092 (Previous Catalog # AAPP06324)
Printable datasheet for anti-KCNMA1 (ARP35092_P050) antibody
Target Reference:
Cambien,B., (2008) Int. J. Cancer 123 (2), 365-371

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...