Search Antibody, Protein, and ELISA Kit Solutions

KCNMA1 Antibody - C-terminal (ARP35092_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP35092_P050-FITC Conjugated

ARP35092_P050-HRP Conjugated

ARP35092_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-14746 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the c terminal region of human KCNMA1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-KCNMA1 (ARP35092_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KCNMA1 (ARP35092_P050) antibody is Catalog # AAP35092 (Previous Catalog # AAPP06324)
Datasheets/Manuals:
Printable datasheet for anti-KCNMA1 (ARP35092_P050) antibody
Subunit:
alpha-1
Target Reference:
Cambien,B., (2008) Int. J. Cancer 123 (2), 365-371
Gene Symbol:
KCNMA1
Official Gene Full Name:
Potassium large conductance calcium-activated channel, subfamily M, alpha member 1
Alias Symbols:
BKTM, DKFZp686K1437, KCa1.1, MGC71881, MaxiK, SAKCA, SLO, SLO-ALPHA, mSLO1, SLO1, bA205K10.1
NCBI Gene Id:
3778
Protein Name:
Calcium-activated potassium channel subunit alpha-1
Description of Target:
MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits.MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified.
Swissprot Id:
Q12791
Protein Accession #:
NP_001014797
Nucleotide Accession #:
NM_001014797
Protein Size (# AA):
1182
Molecular Weight:
131kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KCNMA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KCNMA1.
Protein Interactions:
EED; TBXA2R; KCNMB1; KCNMA1; CAV3; CAV2; CAV1; ACTG2; ACTA2; ALB; CACNA1H; PTK2; MAP1A; GGT1; HMOX2;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...