Now Offering Over 102,157 Antibodies & 44,722 Antigens!

KCNMA1 antibody - C-terminal (ARP35092_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP35092_P050-FITC Conjugated

ARP35092_P050-HRP Conjugated

ARP35092_P050-Biotin Conjugated

Gene Symbol:
KCNMA1
NCBI Gene Id:
3778
Official Gene Full Name:
Potassium large conductance calcium-activated channel, subfamily M, alpha member 1
Protein Name:
Calcium-activated potassium channel subunit alpha-1
Swissprot Id:
Q12791
Protein Accession #:
NP_001014797
Nucleotide Accession #:
NM_001014797
Alias Symbols:
BKTM, DKFZp686K1437, KCa1.1, MGC71881, MaxiK, SAKCA, SLO, SLO-ALPHA, mSLO1, SLO1, bA205K10.1
Replacement Item:
This antibody may replace item sc-14746 from Santa Cruz Biotechnology.
Description of Target:
MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits.MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit, which is the product of this gene, and the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein Size (# AA):
1182
Molecular Weight:
131kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KCNMA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KCNMA1.
Immunogen:
The immunogen is a synthetic peptide directed towards the c terminal region of human KCNMA1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-KCNMA1 (ARP35092_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
EED; TBXA2R; KCNMB1; KCNMA1; CAV3; CAV2; CAV1; ACTG2; ACTA2; ALB; CACNA1H; PTK2; MAP1A; GGT1; HMOX2;
Blocking Peptide:
For anti-KCNMA1 (ARP35092_P050) antibody is Catalog # AAP35092 (Previous Catalog # AAPP06324)
Datasheets/Manuals:
Printable datasheet for anti-KCNMA1 (ARP35092_P050) antibody
Subunit:
alpha-1
Target Reference:
Cambien,B., (2008) Int. J. Cancer 123 (2), 365-371

Tell us what you think about this item!

Write A Review
    Please, wait...