KCNJ11 Antibody - middle region (ARP35168_P050)

Catalog No: ARP35168_P050

Host: Rabbit
Target Name: KCNJ11
Sample Type: Fetal Heart lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of HUMAN KCNJ11
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: SMIISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLII
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KCNJ8 (ARP35168_P050) antibody is Catalog # AAP35168

Target Info

• Gene Symbol: KCNJ11
• Gene Full Name: potassium inwardly-rectifying channel, subfamily J, member 8
• Alias Symbols: BIR, HHF2, PHHI, IKATP, PNDM2, TNDM3, KIR6.2, MODY13
• NCBI Gene Id: 3767
• Protein Name: ATP-sensitive inward rectifier potassium channel 8
• Description of Target: Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins and is found associated with the sulfonylurea receptor SUR. Mutations in this gene are a cause of familial persistent hyperinsulinemic hypoglycemia of infancy (PHHI), an autosomal recessive disorder characterized by unregulated insulin secretion. Defects in this gene may also contribute to autosomal dominant non-insulin-dependent diabetes mellitus type II (NIDDM), transient neonatal diabetes mellitus type 3 (TNDM3), and permanent neonatal diabetes mellitus (PNDM).
• Uniprot ID: Q14654-2
• Protein Accession #: NP_001159762
• Nucleotide Accession #: NM_001166290
• Protein Size (# AA): 303
• Molecular Weight: 33kDa
• Protein Interactions: YWHAB; UBC; ABCC9; AP2M1; KCNJ8; KCNJ2; ABCC8; LDHA;