Search Antibody, Protein, and ELISA Kit Solutions

KCNIP3 Antibody - N-terminal region (ARP88612_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
KCNIP3
Official Gene Full Name:
potassium voltage-gated channel interacting protein 3
NCBI Gene Id:
30818
Protein Name:
Calsenilin
Swissprot Id:
Q9Y2W7
Protein Accession #:
NP_001030086.1
Nucleotide Accession #:
NM_001034914.1
Alias Symbols:
CSEN, DREAM, KCHIP3
Description of Target:
This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domains. They are integral subunit components of native Kv4 channel complexes that may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The encoded protein also functions as a calcium-regulated transcriptional repressor, and interacts with presenilins. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein Size (# AA):
256
Molecular Weight:
29 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KCNIP3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KCNIP3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP3
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGSDSSD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KCNIP3 (ARP88612_P050) antibody is Catalog # AAP88612
Datasheets/Manuals:
Printable datasheet for anti-KCNIP3 (ARP88612_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...