Search Antibody, Protein, and ELISA Kit Solutions

KCNIP3 Antibody - N-terminal region (ARP88612_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
potassium voltage-gated channel interacting protein 3
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domains. They are integral subunit components of native Kv4 channel complexes that may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The encoded protein also functions as a calcium-regulated transcriptional repressor, and interacts with presenilins. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein Size (# AA):
Molecular Weight:
29 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KCNIP3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KCNIP3.
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP3
Peptide Sequence:
Synthetic peptide located within the following region: LLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGSDSSD
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KCNIP3 (ARP88612_P050) antibody is Catalog # AAP88612
Printable datasheet for anti-KCNIP3 (ARP88612_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...