KCNE2 Recombinant Protein (Rat) (OPCA01672)

Catalog No: OPCA01672

Kcne2 Recombinant Protein (Rat) (OPCA01672) in SDS-PAGE showing the molecular weight of approximately 18.4 kDa.

Product Info

• Predicted Species Reactivity: Rat|Rattus norvegicus
• Product Format: Liquid or Lyophilized powder
• Host: Rat
• Additional Information: Relevance: Ancillary protein that assbles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr). May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with KCNQ1/KCLQT1 and elicit a voltage-independent current .
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP
• Protein Sequence: MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-123 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: MinK-related peptide 1 a beta subunit for the HCN ion channel subunit family enhances expression and speeds activation.Yu H., Wu J., Potapova I., Wymore R.T., Holmes B., Zuckerman J., Pan Z., Wang H., Shi W., Robinson R.B., El-Maghrabi M.R., Benjamin W., Dixon J.E., McKinnon D., Cohen I.S., Wymore R.Circ. Res. 88:E84-E87(2001)
• Gene Symbol: Kcne2
• Gene Full Name: potassium voltage-gated channel subfamily E regulatory subunit 2
• Alias Symbols: minimum potassium ion channel-related peptide 1;minK-related peptide 1;Mirp1;potassium channel subunit beta MiRP1;potassium channel, voltage gated subfamily E regulatory beta subunit 2;potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 2;potassium voltage-gated channel subfamily E member 2;potassium voltage-gated channel, Isk-related family, member 2;potassium voltage-gated channel, Isk-related subfamily, gene 2.
• NCBI Gene Id: 171138
• Protein Name: Potassium voltage-gated channel subfamily E member 2
• Description of Target: Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 (PubMed:19219384). Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr). May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with HCN1 and HCN2 and increase potassium current (By similarity). Interacts with KCNQ1; forms a heterooligomer complex leading to currents with an apparently instantaneous activation, a rapid deactivation process and a linear current-voltage relationship and decreases the amplitude of the outward current (By similarity).
• Uniprot ID: P63161
• Protein Accession #: NP_598287.1
  
• Nucleotide Accession #: NM_133603.2
• Protein Size (# AA): Recombinant
• Molecular Weight: 18.4 kDa