Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP35460_P050
Price: $0.00
SKU
ARP35460_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-KCNAB2 (ARP35460_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human KCNAB2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: SSVLLGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKPYSKKDYRS
Concentration0.5 mg/ml
Blocking PeptideFor anti-KCNAB2 (ARP35460_P050) antibody is Catalog # AAP35460 (Previous Catalog # AAPP07279)
Sample Type Confirmation

KCNAB2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Subunitbeta-2
ReferenceLim,J., (2006) Cell 125 (4), 801-814
Gene SymbolKCNAB2
Gene Full NamePotassium voltage-gated channel, shaker-related subfamily, beta member 2
Alias SymbolsAKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2
NCBI Gene Id8514
Protein NameKCNAB2 protein EMBL CAG47060.1
Description of TargetThis gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms.
Uniprot IDQ6FG44
Protein Accession #NP_742128
Nucleotide Accession #NM_172130
Protein Size (# AA)353
Molecular Weight39kDa
Protein InteractionsKCNAB2; SIRT1; KCNA5; KCNA4; UBC; RPA3; RPA2; RPA1; ATXN1; Nedd4; NEDD4L; SLC39A2; SLC39A1; SQSTM1; CD4; KCNA2;
  1. What is the species homology for "KCNAB2 Antibody - middle region (ARP35460_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "KCNAB2 Antibody - middle region (ARP35460_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KCNAB2 Antibody - middle region (ARP35460_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KCNAB2 Antibody - middle region (ARP35460_P050)"?

    This target may also be called "AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2" in publications.

  5. What is the shipping cost for "KCNAB2 Antibody - middle region (ARP35460_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KCNAB2 Antibody - middle region (ARP35460_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KCNAB2 Antibody - middle region (ARP35460_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KCNAB2 Antibody - middle region (ARP35460_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KCNAB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KCNAB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KCNAB2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KCNAB2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KCNAB2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KCNAB2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KCNAB2 Antibody - middle region (ARP35460_P050)
Your Rating
We found other products you might like!