KCNA2 Antibody - N-terminal region : FITC (ARP76317_P050-FITC)

Catalog No: ARP76317_P050-FITC

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCNA2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: AAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KCNA2 (ARP76317_P050-FITC) antibody is Catalog # AAP76317
• Reference: N/A

Target Info

• Gene Symbol: KCNA2
• Alias Symbols: HK4, MK2, HBK5, NGK1, RBK2, DEE32, HUKIV, KV1.2, EIEE32
• NCBI Gene Id: 3737
• Description of Target: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1.
• Uniprot ID: P16389
• Protein Accession #: NP_004965.1
• Protein Size (# AA): 499
• Molecular Weight: 54 kDa