KCNA1 Antibody - middle region : FITC (ARP34923_P050-FITC)

Catalog No: ARP34923_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNA1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KCNA1 (ARP34923_P050-FITC) antibody is Catalog # AAP34923 (Previous Catalog # AAPP06147)
• Reference: Tan,K.M., (2008) Neurology 70 (20), 1883-1890

Target Info

• Gene Symbol: KCNA1
• Gene Full Name: Potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
• Alias Symbols: EA1, MK1, AEMK, HBK1, HUK1, MBK1, RBK1, KV1.1
• NCBI Gene Id: 3736
• Protein Name: Potassium voltage-gated channel subfamily A member 1
• Description of Target: KCNA1 mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). Sequence Note: This RefSeq record was created largely from genomic sequence because transcripts were not available for the entire length of the gene. This transcript is supported by sequences from mouse. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q09470
• Protein Accession #: NP_000208
• Nucleotide Accession #: NM_000217
• Protein Size (# AA): 495
• Molecular Weight: 56kDa
• Protein Interactions: KCNRG; KCNE4; DLG4; DLG1; KCNA4; KCNA3; KCNA2; RTN4; CNTNAP1;