Size:100 ul
Special Price $229.00 Regular Price $249.00
In stock
SKU
ARP38732_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38732_T100-FITC Conjugated

ARP38732_T100-HRP Conjugated

ARP38732_T100-Biotin Conjugated

KBTBD10 Antibody - N-terminal region (ARP38732_T100)

Catalog#: ARP38732_T100
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KBTBD10
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-KBTBD10 (ARP38732_T100)
Peptide Sequence Synthetic peptide located within the following region: MDSQRELAEELRLYQSTLLQDGLKDLLDEKKFIDCTLKAGDKSLPCHRLI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KLHL41 (ARP38732_T100) antibody is Catalog # AAP38732 (Previous Catalog # AAPP20938)
Datasheets/Manuals Printable datasheet for anti-KLHL41 (ARP38732_T100) antibody
Target Reference Lim,D.S., et al., (2001) J. Am. Coll. Cardiol. 38 (4), 1175-1180
Publications

du Puy, L. et al. Sarcosin (Krp1) in skeletal muscle differentiation: gene expression profiling and knockdown experiments. Int. J. Dev. Biol. 56, 301-9 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22562206

Gene Symbol KLHL41
Official Gene Full Name Kelch repeat and BTB (POZ) domain containing 10
Alias Symbols SARCOSIN, KBTBD10
NCBI Gene Id 10324
Protein Name Kelch repeat and BTB domain-containing protein 10
Description of Target KBTBD10 contains 1 BTB (POZ) domain and is required for pseudopod elongation in transformed cells. KBTBD10 mRNA is up-regulated by less than two folds in the heart in human patients with HCM.
Swissprot Id O60662
Protein Accession # NP_006054
Nucleotide Accession # NM_006063
Protein Size (# AA) 606
Molecular Weight 68kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KBTBD10.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KBTBD10.
Protein Interactions RCHY1; SLC2A4; UBC; RBX1; CUL3; NRAP;
Write Your Own Review
You're reviewing:KBTBD10 Antibody - N-terminal region (ARP38732_T100)
Your Rating