Search Antibody, Protein, and ELISA Kit Solutions

KBTBD10 Antibody - N-terminal region (ARP38732_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38732_T100-FITC Conjugated

ARP38732_T100-HRP Conjugated

ARP38732_T100-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
Kelch repeat and BTB (POZ) domain containing 10
NCBI Gene Id:
Protein Name:
Kelch repeat and BTB domain-containing protein 10
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
KBTBD10 contains 1 BTB (POZ) domain and is required for pseudopod elongation in transformed cells. KBTBD10 mRNA is up-regulated by less than two folds in the heart in human patients with HCM.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KBTBD10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KBTBD10.
The immunogen is a synthetic peptide directed towards the N terminal region of human KBTBD10
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-KBTBD10 (ARP38732_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MDSQRELAEELRLYQSTLLQDGLKDLLDEKKFIDCTLKAGDKSLPCHRLI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-KLHL41 (ARP38732_T100) antibody is Catalog # AAP38732 (Previous Catalog # AAPP20938)
Printable datasheet for anti-KLHL41 (ARP38732_T100) antibody
Target Reference:
Lim,D.S., et al., (2001) J. Am. Coll. Cardiol. 38 (4), 1175-1180

du Puy, L. et al. Sarcosin (Krp1) in skeletal muscle differentiation: gene expression profiling and knockdown experiments. Int. J. Dev. Biol. 56, 301-9 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22562206

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...