- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for anti-KAT2B (ARP90642_P050) antibody |
|---|
| Predicted Species Reactivity | Mouse |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse KAT2B |
| Purification | Affinity purified |
| Peptide Sequence | Synthetic peptide located within the following region: SCKCNGWKNPNPSPTPPRGDLQQIIVSLTESCRSCSHALAAHVSHLENVS |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-KAT2B (ARP90642_P050) antibody is Catalog # AAP90642 |
| Gene Symbol | KAT2B |
|---|---|
| Gene Full Name | K(lysine) acetyltransferase 2B |
| Alias Symbols | Pc, Pcaf, p/CAF, AI461839, AW536563, A930006P13Rik |
| NCBI Gene Id | 18519 |
| Protein Name | histone acetyltransferase KAT2B |
| Description of Target | Functions as a histone acetyltransferase (HAT) to promote transcriptional activation. Has significant histone acetyltransferase activity with core histones (H3 and H4), and also with nucleosome core particles. Also acetylates non-histone proteins, such as ACLY, PLK4 and TBX5. Inhibits cell-cycle progression and counteracts the mitogenic activity of the adenoviral oncoprotein E1A. Acts as a circadian transcriptional coactivator which enhances the activity of the circadian transcriptional activators: NPAS2-ARNTL/BMAL1 and CLOCK-ARNTL/BMAL1 heterodimers. Involved in heart and limb development by mediating acetylation of TBX5, acetylation regulating nucleocytoplasmic shuttling of TBX5. Acts as a negative regulator of centrosome amplification by mediating acetylation of PLK4. |
| Uniprot ID | Q9JHD1 |
| Protein Accession # | NP_064389.2 |
| Nucleotide Accession # | NM_020005.4 |
| Protein Size (# AA) | 813 |
| Molecular Weight | 89 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "KAT2B Antibody - N-terminal region (ARP90642_P050)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse".
-
How long will it take to receive "KAT2B Antibody - N-terminal region (ARP90642_P050)"?
This item is available "Domestic: within 24 hours delivery | International: 3-5 days".
-
What buffer format is "KAT2B Antibody - N-terminal region (ARP90642_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "KAT2B Antibody - N-terminal region (ARP90642_P050)"?
This target may also be called "Pc, Pcaf, p/CAF, AI461839, AW536563, A930006P13Rik" in publications.
-
What is the shipping cost for "KAT2B Antibody - N-terminal region (ARP90642_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "KAT2B Antibody - N-terminal region (ARP90642_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "KAT2B Antibody - N-terminal region (ARP90642_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "89 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "KAT2B Antibody - N-terminal region (ARP90642_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "KAT2B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "KAT2B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "KAT2B"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "KAT2B"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "KAT2B"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "KAT2B"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.