Search Antibody, Protein, and ELISA Kit Solutions

KAT2B Antibody - C-terminal region (ARP75221_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
KAT2B
Official Gene Full Name:
lysine acetyltransferase 2B
NCBI Gene Id:
8850
Protein Name:
Histone acetyltransferase KAT2B
Swissprot Id:
Q92831
Protein Accession #:
NP_003875.3
Nucleotide Accession #:
NM_003884.4
Alias Symbols:
CAF, PCAF, P/CAF
Description of Target:
CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.
Protein Size (# AA):
832
Molecular Weight:
91 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KAT2B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KAT2B.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human KAT2B
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: ESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFME
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KAT2B (ARP75221_P050) antibody is Catalog # AAP75221
Datasheets/Manuals:
Printable datasheet for anti-KAT2B (ARP75221_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...